KEGG   Streptomyces albus: XNR_0580Help
Entry
XNR_0580          CDS       T02545                                 

Definition
Class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
salb  Streptomyces albus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    XNR_0580
Enzymes [BR:salb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     XNR_0580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(681033..681782)
Genome map
AA seq 249 aa AA seqDB search
MTTSTRERGHPAPAVPARLAGQIAIGARMLSLDGHDDFNQGQISARMPGSSTFFIKNALC
GFDEASPDQVVAASVDPDAATHPLAPPELPLHQAIYRARPDVNGIVHSHAPHTLVFGATD
LELRPVSHDGAHFADRLGLFTRTSNTVLDQETGEAIAETLGGGEGVLLRNHGGVVVGKSV
RHAAVFAQVLERACRLQLLAEQSGVPYTWATDDDIRLKRDFIYADLSVRSYWDYAVRRVG
RVWPEAVPW
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacatccacgcgtgagcgagggcaccccgcgcccgccgtcccggcccgcctggcc
gggcagatcgccatcggcgcccgcatgctgtcgctggacggacacgacgacttcaaccag
gggcagatatcggcccgcatgccgggctcctccaccttcttcatcaagaacgccctctgc
ggcttcgacgaggcgagccccgaccaggtggtggccgcgtcggtcgatcccgacgcggcc
acgcatccgctcgcgccgcccgaactcccgctgcaccaggcgatctaccgggcccgcccc
gacgtcaacggcatcgtgcacagccacgctccgcacacgttggtcttcggcgcgaccgac
ctcgaactccggccggtctcgcacgacggagcccacttcgccgaccgcctcggcctgttc
accaggaccagcaacaccgtcctcgaccaggagacgggcgaggccatcgccgagacactc
ggtggcggggagggagtgctgctgcgcaaccacggcggagtcgtcgtcggcaagagcgtg
cggcatgccgcggtcttcgcgcaggtgctggaacgcgcctgccgcctccagctcctggcc
gagcagagcggggtgccgtacacctgggccaccgacgacgacatccggctcaagcgggac
ttcatctacgccgacctctccgtccgctcgtactgggactacgccgttcgccgggtcggg
cgggtctggcctgaggccgtgccgtggtga

DBGET integrated database retrieval system