KEGG   Streptomyces albus: XNR_0875Help
Entry
XNR_0875          CDS       T02545                                 

Definition
Alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
salb  Streptomyces albus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XNR_0875
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    XNR_0875
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XNR_0875
Enzymes [BR:salb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     XNR_0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1027236..1028930
Genome map
AA seq 564 aa AA seqDB search
MPTASLPDSPTPRTVPAPSAAPSRSARHDAALRAAARGLDRRRLLTLGGAAAALAFATNL
PAAGAAQAAGFDARRLREDPFTLGVASGDPHPSSVLLWTRLAPRPFEPDSGLPAQRITVE
WELARDERFRRVVRRGRETAHPEFHHSVHVQVDGLDADRVYYYRFRAGAFTSPAGRTRTT
PRQGARTRELALAAVSCQAYHDGYFTAYRHLAAEDVDVVLHLGDYLYEYAVNGAGGARNY
TDRVLPAVFDRETMTLEDYRLRYGLYKSDPDLIAAHAAHPFVVTWDDHETENNYAGNQPE
NDVDPEEFLLRRASAYRAYWENQPLRLPQRPTGPDMRLYRRLHWGDLAQFDILDTRQYRS
DQAYGDGWKTPGPESEDPARTMTGGAQERWLLDGWRTSRARWNVVPQQVTFSERRNATGS
AYKLSMDSWDGYPASRERLLAGAEQAGVDHLMVLTGDVHVGYGFDIKRDFADQGSRTVGT
ELVATSIASGKDGADRPANWETYHAANPHLKFYNGRRGYLTVRLGEESARADFRTVSAVT
VPGAPLTTAGSFVTERRSPGLKPA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
gtgcccactgcttccctgcctgactcccccaccccccgtaccgttcccgcaccgtccgcc
gcgccttcccggtccgcgcgccacgatgccgccctgcgggcggccgcccggggcctggac
cggcggcggctgctgacgctgggcggggccgccgccgcgctggccttcgccaccaacctg
ccggcggcgggggcggcgcaggccgccgggttcgacgcgcgacggctgcgcgaggacccg
ttcaccctcggcgtggcctccggcgacccgcacccgtcctcggtgctgctgtggacccgg
ctcgcgccgcgccccttcgagccggacagcgggctgcccgcgcagcggatcaccgtggag
tgggagctggcccgcgacgagcggttccgccgggtcgtcagacgcggccgggagactgcc
caccccgagttccaccacagcgtccacgtgcaggtggacggcctggacgcggaccgggtc
tactactaccgcttccgcgccggagcgttcaccagccccgccggccgcacccgcaccacg
ccccgccagggcgccaggacccgcgaactggccctcgccgccgtctcctgccaggcgtac
cacgacggctacttcaccgcctaccgccacctcgcggccgaggacgtcgacgtcgtcctg
cacctcggtgactacctctacgagtacgccgtgaacggcgccggaggggcccgcaactac
accgaccgggtgctgccggccgtcttcgaccgggagaccatgacgctggaggactaccgg
ctgcggtacggcctctacaaatccgacccggacctgatcgccgcccacgccgcccacccc
ttcgtggtcacctgggacgaccacgagacggagaacaactacgcgggcaaccagccggag
aacgacgtggacccggaggagttcctgctccgccgggcctccgcctaccgcgcgtactgg
gagaaccagccgctgcggctgccgcagcgccccaccggccccgacatgcggctctaccgg
cggctgcactggggcgacctggcccagttcgacatcctcgacacccgccagtaccgctcc
gaccaggcgtacggcgacggctggaagacgccggggcccgagtccgaggaccccgcgcgc
accatgaccggcggggcgcaggagcggtggctgctcgacgggtggcgcacctcgcgggcc
cgctggaacgtggtcccgcagcaggtgaccttctccgagcggcgcaacgccaccggctcc
gcctacaagctctcgatggactcctgggacggctacccggcctcccgcgagcggctcctc
gccggggccgaacaggcgggcgtcgaccacctgatggtcctcaccggggacgtgcacgtc
ggctacggcttcgacatcaagcgggacttcgccgaccagggctcgcgcaccgtcggcacc
gaactggtcgccacctcgatcgccagcggcaaggacggcgccgaccggcccgccaactgg
gagacgtaccacgcggccaacccgcacctgaagttctacaacgggcgccgcggctacctc
accgtccgcctcggcgaggagtcggcgcgcgccgacttccgcaccgtctccgccgtcacc
gtgcccggcgccccgctcaccaccgccggatcgttcgtcaccgagcgccgctcccccggc
ctgaagcccgcctga

DBGET integrated database retrieval system