KEGG   Streptomyces albus: XNR_0917Help
Entry
XNR_0917          CDS       T02545                                 

Definition
Dehydrogenase
Organism
salb  Streptomyces albus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1079098..1080228
Genome map
AA seq 376 aa AA seqDB search
MKALVYQGPREVTVEEVPDARIERPTDVLVRVTSTNICGSDLHMYEGRTTLETGRVLGHE
NLGVVVEVGSGVDRVKTGDRVCLPFNVACGFCENCEAERTGFCLTVDSDTPGGAYGFAEM
GTYAGGQAEFLRVPWGDFNCLVLPEDAQEKENDYVMLSDIFPTGYHATELAGVSPGESVV
VYGAGPVGLMAAYSAALRGAGQVLVVDHHPDRLALAEKAGAIPVDDTEGDHVEQILERTG
GGADKGCECVGYQAHDADGNEKPESTMNDLVASVRATGAIGVVGVFLPQDDGAPTELTRE
GKLPFDFGDFWFKGQRIGTGQANVKAYNRQLRDLIHHDKAKPSFIVSHELPLDDAPEAYR
NFDDRLSGWTKVILKP
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactggtctaccagggcccccgcgaggtcacggtcgaagaggtcccggacgcg
cggatcgaacgccccacggacgtcctggtgcgggtcacgtccaccaacatctgcggctcc
gacctccacatgtacgagggccgcaccaccctggagacgggccgcgtcctcggccacgag
aacctcggcgtggtggtcgaggtcggctcgggcgtggaccgcgtcaagaccggcgaccgg
gtctgtctccccttcaacgtggcctgcggcttctgcgagaactgcgaggccgaacggaca
ggtttctgcctcaccgtcgactccgacaccccgggcggcgcctacggcttcgccgagatg
ggcacctacgccggcggccaggccgagttcctgcgggtgccgtggggcgacttcaactgc
ctggtcctgcccgaggacgcgcaggagaaggagaacgactacgtgatgctgtcggacatc
ttcccgaccggctatcacgccacggaactcgccggcgtctccccgggcgagtccgtcgtc
gtctacggagcgggcccggtcggcctgatggcggcgtactcggcggcgctgcgcggcgcc
ggccaggtcctggtcgtcgaccaccacccggaccgtctcgcgctggccgagaaggccggg
gcgatccccgtcgacgacaccgagggcgaccacgtcgagcagatcctggagcggaccggc
ggcggcgccgacaaggggtgcgagtgcgtcggctaccaggcgcacgacgccgacgggaac
gagaagccggagtcgaccatgaacgacctggtcgcctcggtgcgggcgaccggcgccatc
ggcgtggtcggggtcttcctgccgcaggacgacggagcgcccaccgagctgacccgtgaa
ggcaaactccccttcgacttcggcgacttctggttcaaggggcagcggatcggcaccggc
caggccaacgtcaaggcgtacaaccgccagttgcgggacctcatccaccacgacaaggcc
aagccgtcgttcatcgtctcgcacgaactgccgctggacgacgcgcccgaggcgtaccgg
aacttcgacgaccggctctccggctggaccaaggtcatcctcaagccctga

DBGET integrated database retrieval system