KEGG   Streptomyces albus: XNR_0917Help
Entry
XNR_0917          CDS       T02545                                 

Definition
Dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
salb  Streptomyces albus
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XNR_0917
  Energy metabolism
   00680 Methane metabolism
    XNR_0917
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XNR_0917
Enzymes [BR:salb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     XNR_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1079098..1080228
Genome map
AA seq 376 aa AA seqDB search
MKALVYQGPREVTVEEVPDARIERPTDVLVRVTSTNICGSDLHMYEGRTTLETGRVLGHE
NLGVVVEVGSGVDRVKTGDRVCLPFNVACGFCENCEAERTGFCLTVDSDTPGGAYGFAEM
GTYAGGQAEFLRVPWGDFNCLVLPEDAQEKENDYVMLSDIFPTGYHATELAGVSPGESVV
VYGAGPVGLMAAYSAALRGAGQVLVVDHHPDRLALAEKAGAIPVDDTEGDHVEQILERTG
GGADKGCECVGYQAHDADGNEKPESTMNDLVASVRATGAIGVVGVFLPQDDGAPTELTRE
GKLPFDFGDFWFKGQRIGTGQANVKAYNRQLRDLIHHDKAKPSFIVSHELPLDDAPEAYR
NFDDRLSGWTKVILKP
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactggtctaccagggcccccgcgaggtcacggtcgaagaggtcccggacgcg
cggatcgaacgccccacggacgtcctggtgcgggtcacgtccaccaacatctgcggctcc
gacctccacatgtacgagggccgcaccaccctggagacgggccgcgtcctcggccacgag
aacctcggcgtggtggtcgaggtcggctcgggcgtggaccgcgtcaagaccggcgaccgg
gtctgtctccccttcaacgtggcctgcggcttctgcgagaactgcgaggccgaacggaca
ggtttctgcctcaccgtcgactccgacaccccgggcggcgcctacggcttcgccgagatg
ggcacctacgccggcggccaggccgagttcctgcgggtgccgtggggcgacttcaactgc
ctggtcctgcccgaggacgcgcaggagaaggagaacgactacgtgatgctgtcggacatc
ttcccgaccggctatcacgccacggaactcgccggcgtctccccgggcgagtccgtcgtc
gtctacggagcgggcccggtcggcctgatggcggcgtactcggcggcgctgcgcggcgcc
ggccaggtcctggtcgtcgaccaccacccggaccgtctcgcgctggccgagaaggccggg
gcgatccccgtcgacgacaccgagggcgaccacgtcgagcagatcctggagcggaccggc
ggcggcgccgacaaggggtgcgagtgcgtcggctaccaggcgcacgacgccgacgggaac
gagaagccggagtcgaccatgaacgacctggtcgcctcggtgcgggcgaccggcgccatc
ggcgtggtcggggtcttcctgccgcaggacgacggagcgcccaccgagctgacccgtgaa
ggcaaactccccttcgacttcggcgacttctggttcaaggggcagcggatcggcaccggc
caggccaacgtcaaggcgtacaaccgccagttgcgggacctcatccaccacgacaaggcc
aagccgtcgttcatcgtctcgcacgaactgccgctggacgacgcgcccgaggcgtaccgg
aacttcgacgaccggctctccggctggaccaaggtcatcctcaagccctga

DBGET integrated database retrieval system