KEGG   Streptomyces albus: XNR_1397Help
Entry
XNR_1397          CDS       T02545                                 

Definition
1,4-alpha-glucan (glycogen) branching enzyme, GH-13-type (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
salb  Streptomyces albus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XNR_1397
Enzymes [BR:salb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     XNR_1397
Exosome [BR:salb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XNR_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1667579..1670431
Genome map
AA seq 950 aa AA seqDB search
MTPRPPAPEPSDAAEPPAPLVPAPARGEDRETEAPAAASPDPERAAGTGTDPKAATATRT
RPAPATAPGTDNEDVARARTGRPRSTKSGSAGKPAKASGKPSREPAARPEEPAEPTTSVT
GDGAPKPKAKPKTRTRTTAKAGTATKAKAATATGAESTAKSGTEAAARSGAKAGAKSGAK
AGAKTPAKSRAKTPAKPGRTPAARTRRPVAATEPPASPYAPHPDDRGRLLHGHHHDPHGV
LGAHPAKDGIVVRALRPYATGVAVVAEGLRVALADDGDGFFSGLLPVASVPDYRLEITYP
GQEGGPGHTLTTPDPYRMLPSLGSFDLHLIGEGRHEELWRALGARPMTHEGVTGTRFAVW
APNARGVRIIGDFNYWDGTAYPMRSLGSSGIWELFVPGVGEGALYRFEIARPDGSLTRRS
DPMARRTEVPPANASVVADSHHTWGDQAWLARRGQTPVHEAPFSVYEVHLASWRPGLTYR
QLAEQLPAYVKDLGFTHVELMPVAEHPFGGSWGYQVTGFYAPTARLGTPDDFKYLVDALH
QAGIGVLMDWVPAHFPRDDWALAEFDGRPLYEHPDPLRAAHPDWGTLEFDYGRTEVRNFL
VANAVYWCEEFHIDGLRVDAVASMLYLDYSREDGQWSPNEYGGRENHDAVAFLQEMNATV
YRRAPGVVTIAEESTAWDGVTRPTHLTGEGGFGGLGFGLKWNMGWMHDSLEYMAKEPVHR
RYHHNEMTFSMVYAYSENYVLPISHDEVVHGKQALVSKMPGDWWQRRADHRAYLGFMWAH
PGKQLLFMGQEFAQGAEWSEEHGPDWWLLDPAYGAEADHRGVRDLVRELNTVYGATPALW
QRDTDPGGFAWIVSDAAEDNVLAFLRHDHQGAPLLAVSNFSPVVRHGYALGVPDAHTVWR
EVLNTDEERYGGGGIGNPEPLKPGEPGTHGRPAALRLTLPPLATVWLRPA
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccccgtccgcccgcccccgaaccctccgacgcggccgagccgcccgctcccctg
gtccccgccccggcccgcggggaggaccgggagaccgaggccccggccgccgcctccccc
gaccccgagcgcgccgcgggcaccggtaccgacccgaaggcggccaccgccacccgcacc
cgcccggccccggccaccgcacccggcaccgacaacgaggacgtggcccgcgcccgtacc
ggccgcccccgctccaccaagtccggcagcgcgggcaagcccgccaaggcgagcggcaag
ccctcgcgcgagccggccgcgcggccggaggagcccgccgagccgaccacctcggtgacc
ggcgacggcgcgccgaagcccaaggcgaagccgaagacccgcaccaggaccaccgccaag
gccggcaccgcgacgaaggcgaaggcggccacggccaccggggccgagtccaccgcgaag
agcggcaccgaggcggcggccaggtccggcgcgaaggcgggcgccaagtccggtgccaag
gccggcgccaagacacccgccaagtcccgcgccaagaccccggccaagcccggccgcacc
cccgccgcccgcacccggcgccccgtggcggccaccgagccgcccgcctcgccgtacgcc
ccgcaccccgacgaccggggccgcctgctccacggccaccaccacgacccgcacggcgtg
ctcggcgcgcacccggccaaggacggcatcgtggtgcgggcgctgcgcccgtacgccacc
ggggtcgcggtggtcgccgaggggctgcgggtcgccctggccgacgacggcgacgggttc
ttctcggggctgctgccggtggcctcggtccccgactaccggctggagatcacctacccg
ggccaggagggcggccccggccacaccctcaccacccccgacccgtaccgcatgctcccc
tcgctcggctccttcgacctgcacctgatcggtgaggggcggcacgaggagctgtggcgg
gcgctgggggcgcggccgatgacgcacgagggggtgaccgggaccaggttcgccgtctgg
gcgccgaacgcacgcggtgtacggatcatcggtgacttcaactactgggacggcacggcg
tacccgatgcgttcgctcggctccagcgggatctgggagctgttcgtgccgggggtcggc
gagggggcgctgtaccggttcgagatcgcccggccggacggttcgctgacccggcgctcc
gacccgatggcccggcgcaccgaggtgccgcccgccaacgcctccgtggtcgccgactcc
caccacacctggggcgaccaggcgtggctggcccggcgcgggcagaccccggtgcacgag
gcgcccttctccgtctacgaggtccacctcgcctcctggcggccggggctcacctaccgg
caactggccgagcagctccccgcgtacgtcaaggacctcggcttcacccatgtcgagctg
atgccggtcgccgagcatcccttcggcggctcctggggctaccaggtgaccgggttctac
gcgccgaccgcgcggctcggcaccccggacgacttcaagtacctggtcgacgccctgcac
caggcgggcatcggcgtgctgatggactgggttccggcgcacttcccgcgcgacgactgg
gccctggcggagttcgacgggcggccgctgtacgagcacccggacccgctccgggcggcg
cacccggactgggggacgctggagttcgactacggccgcaccgaggtccgcaactttctg
gtggccaacgcggtgtactggtgcgaggagttccacatcgacgggctgcgggtcgacgcg
gtcgcctcgatgctctacctcgactactcccgcgaggacggccagtggtcgcccaacgag
tacggcgggcgggagaaccacgacgcggtcgccttcctccaggagatgaacgcgaccgtc
taccgccgggcgcccggcgtggtcaccatcgccgaggagtcgacggcctgggacggcgtc
acccgccccacccatctcaccggcgagggcggcttcggcggcctgggcttcgggctgaag
tggaacatggggtggatgcacgactcgctggagtacatggcgaaggagccggtacaccgc
aggtaccaccacaacgagatgaccttctcgatggtgtacgcctacagcgagaactacgtc
ctgcccatctcgcacgacgaggtggtccacggcaagcaggcgctggtctccaagatgccc
ggcgactggtggcagcggcgcgccgaccaccgcgcctacctcggcttcatgtgggcccat
cccggtaagcaactgcttttcatgggccaggagttcgcccagggcgccgagtggtccgag
gagcacggcccggactggtggctgctggacccggcgtacggcgccgaggccgaccaccgg
ggcgtacgcgacctggtccgcgagctgaacaccgtctacggcgccaccccggccctgtgg
cagcgcgacaccgacccgggcggcttcgcctggatcgtctcggacgcggccgaggacaac
gtcctcgccttcctccgccacgaccaccagggcgcgccgctgctcgcggtcagcaacttc
tccccggtggtccgccacggctacgccctcggcgtgccggacgcccacacggtgtggcgg
gaggtcctcaacaccgacgaggagcggtacggcggcgggggcatcggcaacccggagccc
ctcaagcccggggagcccggcacccacggccgcccggccgccctccggctgaccctgccg
ccgctggccacggtctggctgcggccggcctga

DBGET integrated database retrieval system