KEGG   Streptomyces albus: XNR_1746Help
Entry
XNR_1746          CDS       T02545                                 

Definition
Secreted endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
salb  Streptomyces albus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:salb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2066069..2067097)
Genome map
AA seq 342 aa AA seqDB search
MYGKDTGHGRGFRRRGMGAVAVGAALLLSGCSGSSDDGSEAKPSVSQQPKGEDPYWVNPD
GNAARQVAEFEDEGKKDEAGLVRRIAEQPVADWLGTDQPEEEARGFTEAAKAADREALLV
LYNIPHRDCGNYSGGGAADGNAYRAFVDSVAKGIGDRPATVILEPDAVLHLVDGCTPEQF
HEERYDLLKGAIQTLKALPATKVYLDAGNAGWGKPEQIFEPLTWAGVAEADGFSVNVSNF
YSTGESVAYGKELSAKVGNKPFVVDTSRNGNGPFTGGDPAERWCNPPGRALGEVPTTKTG
DDLVDAYLWIKRPGESDGECKGGPKAGQWWPEYALGLAKAAK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcaaagacaccggccacggccgaggtttccggcgccgggggatgggagcggtg
gccgtgggggcggccctgctcctctccggctgttccggttcgtccgacgacgggagcgag
gccaagcccagcgtgagccagcagcccaagggcgaggacccgtactgggtcaacccggac
ggcaacgcggcccgccaggtcgccgagttcgaggacgagggcaagaaggacgaggccggg
ctggtccgccggatcgcggagcagccggtggccgactggctgggcaccgaccagcccgag
gaggaggcgcgcggcttcaccgaggcggccaaggcggccgaccgcgaggcgctgctggtc
ctctacaacatcccgcaccgcgactgcggcaactactcgggcggcggcgccgccgacggc
aacgcctaccgcgccttcgtcgactccgtcgccaagggcatcggcgaccgcccggccacc
gtcatcctggagccggacgccgtcctccacctggtcgacggctgcacgcccgagcagttc
cacgaggagcggtacgacctcctcaagggcgcgatccagaccctcaaggcgctgcccgcc
accaaggtctacctggacgcgggcaacgccggctggggcaagcccgagcagatcttcgag
ccgctgacctgggcgggcgtcgccgaggccgacggcttctcggtcaacgtctccaacttc
tactccaccggggagtccgtcgcctacggcaaggagctgtccgcgaaggtggggaacaag
cccttcgtcgtcgacaccagccgcaacggcaacggccccttcaccggcggcgacccggcc
gaacgctggtgcaacccgcccggccgcgccctcggcgaggtgcccaccaccaagaccggc
gacgacctcgtcgacgcctacctctggatcaagcgccccggcgagtccgacggcgagtgc
aagggcggcccgaaggccggccagtggtggcccgagtacgcgctgggactggcgaaggcg
gccaagtag

DBGET integrated database retrieval system