KEGG   Streptomyces albus: XNR_1746Help
Entry
XNR_1746          CDS       T02545                                 

Definition
Secreted endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
salb  Streptomyces albus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XNR_1746
Enzymes [BR:salb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XNR_1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2066069..2067097)
Genome map
AA seq 342 aa AA seqDB search
MYGKDTGHGRGFRRRGMGAVAVGAALLLSGCSGSSDDGSEAKPSVSQQPKGEDPYWVNPD
GNAARQVAEFEDEGKKDEAGLVRRIAEQPVADWLGTDQPEEEARGFTEAAKAADREALLV
LYNIPHRDCGNYSGGGAADGNAYRAFVDSVAKGIGDRPATVILEPDAVLHLVDGCTPEQF
HEERYDLLKGAIQTLKALPATKVYLDAGNAGWGKPEQIFEPLTWAGVAEADGFSVNVSNF
YSTGESVAYGKELSAKVGNKPFVVDTSRNGNGPFTGGDPAERWCNPPGRALGEVPTTKTG
DDLVDAYLWIKRPGESDGECKGGPKAGQWWPEYALGLAKAAK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcaaagacaccggccacggccgaggtttccggcgccgggggatgggagcggtg
gccgtgggggcggccctgctcctctccggctgttccggttcgtccgacgacgggagcgag
gccaagcccagcgtgagccagcagcccaagggcgaggacccgtactgggtcaacccggac
ggcaacgcggcccgccaggtcgccgagttcgaggacgagggcaagaaggacgaggccggg
ctggtccgccggatcgcggagcagccggtggccgactggctgggcaccgaccagcccgag
gaggaggcgcgcggcttcaccgaggcggccaaggcggccgaccgcgaggcgctgctggtc
ctctacaacatcccgcaccgcgactgcggcaactactcgggcggcggcgccgccgacggc
aacgcctaccgcgccttcgtcgactccgtcgccaagggcatcggcgaccgcccggccacc
gtcatcctggagccggacgccgtcctccacctggtcgacggctgcacgcccgagcagttc
cacgaggagcggtacgacctcctcaagggcgcgatccagaccctcaaggcgctgcccgcc
accaaggtctacctggacgcgggcaacgccggctggggcaagcccgagcagatcttcgag
ccgctgacctgggcgggcgtcgccgaggccgacggcttctcggtcaacgtctccaacttc
tactccaccggggagtccgtcgcctacggcaaggagctgtccgcgaaggtggggaacaag
cccttcgtcgtcgacaccagccgcaacggcaacggccccttcaccggcggcgacccggcc
gaacgctggtgcaacccgcccggccgcgccctcggcgaggtgcccaccaccaagaccggc
gacgacctcgtcgacgcctacctctggatcaagcgccccggcgagtccgacggcgagtgc
aagggcggcccgaaggccggccagtggtggcccgagtacgcgctgggactggcgaaggcg
gccaagtag

DBGET integrated database retrieval system