KEGG   Streptomyces albus J1074: XNR_3159Help
Entry
XNR_3159          CDS       T02545                                 

Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
salb  Streptomyces albus J1074
Pathway
salb00630  Glyoxylate and dicarboxylate metabolism
salb01100  Metabolic pathways
salb01110  Biosynthesis of secondary metabolites
salb01120  Microbial metabolism in diverse environments
salb01200  Carbon metabolism
Module
salb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XNR_3159
Enzymes [BR:salb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     XNR_3159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL
Motif
Other DBs
NCBI-ProteinID: AGI89502
Position
3608333..3609616
Genome map
AA seq 427 aa AA seqDB search
MAQTPTEAATELARRWAGDPRWKGIERTHTAEDVVRLSGSVREEHTLARRGAERLWRQLH
ERDYVHALGALTGGQAVQMVKAGLQAIYLSGWQVAADANQAGHTYPDQSLYPVNSVPTVV
RRINNALLRADQIATAENAGDTTDWLAPIVADAEAGFGGPLNAFELTKAMIAAGAAGIHY
EDQLASEKKCGHLGGKVLVPTSQHVRTLNAARLAADIADVPTLIVARTDALAANLLTSDV
DEQDARFATGERTAEGFYRVEPGMAPVIARGLAYAPYADLIWVETGTPDLAQAREFAEAL
HARYPDKMLAYNCSPSFNWKAALDDDQIAKFQRELGAMGYRFQFITLAGFHSLNHGMFDL
ARGYAEHGMTAYVDLQEREFAAQAQGFTAVKHQREVGTGYFDLVSTAVNPASTTTALTGS
TEEQQFH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagacaccgaccgaagccgcgaccgagctggcccggcgctgggccggggacccg
cgctggaagggcatcgagcgcacccacaccgccgaggacgtcgtccggctctccggcagc
gtccgcgaggagcacaccctggcccggcgcggcgccgaacgcctctggcgccagctccac
gagcgcgactacgtccacgcgctgggcgccctcaccggcggccaggccgtccagatggtc
aaggccgggctccaggccatctacctctccggctggcaggtcgccgccgacgccaaccag
gccgggcacacctacccggaccagagcctctacccggtcaactccgtgccgaccgtggtc
cgccgcatcaacaacgccctgctgcgcgccgaccagatcgccaccgccgagaacgccggc
gacaccaccgactggctggcgccgatcgtcgccgacgccgaggccgggttcggcggcccg
ctcaacgccttcgagctgaccaaggcgatgatcgcggccggcgccgccggcatccactac
gaggaccagctggcctccgagaagaagtgcggccacctcggcggcaaggtcctggtgccc
acctcccagcacgtccgcaccctcaacgcggcccgtctcgccgccgacatcgccgacgtg
ccgaccctgatcgtcgcccgcaccgacgccctcgccgccaacctcctcaccagcgacgtc
gacgagcaggacgcccgcttcgccaccggcgagcgcaccgccgagggcttctaccgcgtc
gagcccggcatggccccggtcatcgcccgcggcctcgcctacgccccgtacgccgacctc
atctgggtcgagacgggcacccccgacctcgcccaggcccgcgagttcgccgaggcgctg
cacgcgcggtacccggacaagatgctcgcctacaactgctcgccctccttcaactggaag
gccgccctcgacgacgaccagatcgccaagttccagcgcgaactcggcgccatgggctac
cgcttccagttcatcaccctggccggtttccactccctcaaccacggcatgttcgacctg
gcccgcggctacgccgaacacggcatgaccgcctacgtcgacctccaggagcgcgagttc
gccgcccaggcccagggcttcaccgccgtcaagcaccagcgcgaggtcggcaccggctac
ttcgacctcgtctccaccgccgtcaaccccgcctccaccaccaccgccctcaccggctcc
acggaggaacagcagttccactag

DBGET integrated database retrieval system