KEGG   Streptomyces albus: XNR_3159Help
Entry
XNR_3159          CDS       T02545                                 

Definition
Isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
salb  Streptomyces albus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:salb01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:salb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3608333..3609616
Genome map
AA seq 427 aa AA seqDB search
MAQTPTEAATELARRWAGDPRWKGIERTHTAEDVVRLSGSVREEHTLARRGAERLWRQLH
ERDYVHALGALTGGQAVQMVKAGLQAIYLSGWQVAADANQAGHTYPDQSLYPVNSVPTVV
RRINNALLRADQIATAENAGDTTDWLAPIVADAEAGFGGPLNAFELTKAMIAAGAAGIHY
EDQLASEKKCGHLGGKVLVPTSQHVRTLNAARLAADIADVPTLIVARTDALAANLLTSDV
DEQDARFATGERTAEGFYRVEPGMAPVIARGLAYAPYADLIWVETGTPDLAQAREFAEAL
HARYPDKMLAYNCSPSFNWKAALDDDQIAKFQRELGAMGYRFQFITLAGFHSLNHGMFDL
ARGYAEHGMTAYVDLQEREFAAQAQGFTAVKHQREVGTGYFDLVSTAVNPASTTTALTGS
TEEQQFH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagacaccgaccgaagccgcgaccgagctggcccggcgctgggccggggacccg
cgctggaagggcatcgagcgcacccacaccgccgaggacgtcgtccggctctccggcagc
gtccgcgaggagcacaccctggcccggcgcggcgccgaacgcctctggcgccagctccac
gagcgcgactacgtccacgcgctgggcgccctcaccggcggccaggccgtccagatggtc
aaggccgggctccaggccatctacctctccggctggcaggtcgccgccgacgccaaccag
gccgggcacacctacccggaccagagcctctacccggtcaactccgtgccgaccgtggtc
cgccgcatcaacaacgccctgctgcgcgccgaccagatcgccaccgccgagaacgccggc
gacaccaccgactggctggcgccgatcgtcgccgacgccgaggccgggttcggcggcccg
ctcaacgccttcgagctgaccaaggcgatgatcgcggccggcgccgccggcatccactac
gaggaccagctggcctccgagaagaagtgcggccacctcggcggcaaggtcctggtgccc
acctcccagcacgtccgcaccctcaacgcggcccgtctcgccgccgacatcgccgacgtg
ccgaccctgatcgtcgcccgcaccgacgccctcgccgccaacctcctcaccagcgacgtc
gacgagcaggacgcccgcttcgccaccggcgagcgcaccgccgagggcttctaccgcgtc
gagcccggcatggccccggtcatcgcccgcggcctcgcctacgccccgtacgccgacctc
atctgggtcgagacgggcacccccgacctcgcccaggcccgcgagttcgccgaggcgctg
cacgcgcggtacccggacaagatgctcgcctacaactgctcgccctccttcaactggaag
gccgccctcgacgacgaccagatcgccaagttccagcgcgaactcggcgccatgggctac
cgcttccagttcatcaccctggccggtttccactccctcaaccacggcatgttcgacctg
gcccgcggctacgccgaacacggcatgaccgcctacgtcgacctccaggagcgcgagttc
gccgcccaggcccagggcttcaccgccgtcaagcaccagcgcgaggtcggcaccggctac
ttcgacctcgtctccaccgccgtcaaccccgcctccaccaccaccgccctcaccggctcc
acggaggaacagcagttccactag

DBGET integrated database retrieval system