KEGG   Streptomyces albus: XNR_3533Help
Entry
XNR_3533          CDS       T02545                                 

Definition
Uroporphyrinogen-III methyltransferase / Uroporphyrinogen-III synthase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
salb  Streptomyces albus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XNR_3533
Enzymes [BR:salb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     XNR_3533
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     XNR_3533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4049884..4051521
Genome map
AA seq 545 aa AA seqDB search
MFSDHGHVTFLGAGPGDPGLLTLRAVEALAAADVLVAEEQVLDVVRAHARAGADMPQLSA
DEASTPAEARRFGDAANLVMGAARAGKRVVRAVQGDPGLDSEAVREMLACAAEGVTFEVV
PGIAEAVGVPAYAGIPLRDETGADVRFVDARTATERCWTELGASDGTVVVSTSLDQAAAT
AGELVAAGRKPDTPMTLTVAGTTTRQRTWEATLGTVAQVLKQAKVLPSPDGGRPVIAVVG
EHCAPARRDQLSWFESKPLFGWKVLVPRTKEQAASLSDQLRSYGAVPHEVPTIAVEPPRT
PQQMERAVKGLVTGRYEWIAFTSVNAVKAVREKFEEYGLDARAFAGIKVAAVGEQTAAAL
IAFGVKPDLVPSGEQSAAGLLEDWPPYDPVFDPIDRVFLPRADIATETLVAGLIELGWEV
DDVTAYRTVRASPPPADTREAIKGGGFDAVLFTSSSTVRNLVGIAGKPHNVTIIACIGPA
TAKTAEEHGLRVDVMAPEPSVHKLAEALASFGAERRAAALEAGESVARPSERRPGARRRR
AASSS
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgttctccgaccatgggcacgtcaccttcctcggtgccggtcccggcgacccggggctt
ctcactctgcgcgccgtcgaggcgctggccgcggccgacgtcctggtcgcggaggagcag
gtgctcgacgtcgtcagggcgcatgccagggcgggcgcggacatgccgcaactgtccgct
gacgaggcgtcaacccccgcggaggcccgccgattcggcgatgccgccaatcttgtcatg
ggggccgcgcgggccggaaagcgggtcgtgcgcgccgtccagggcgacccggggctcgac
tccgaggccgtccgcgagatgctcgcctgcgccgccgagggcgtcaccttcgaggtggtc
cccggcatcgcggaggcggtcggcgtccccgcgtacgccggtatcccgctgcgcgacgag
accggtgccgacgtgcggttcgtggacgcgcgcaccgccaccgagcgctgctggaccgag
ctgggtgcgagcgacggcaccgtcgtcgtctccaccagcctcgaccaggcggcggccacg
gcgggcgaactggtggcggccgggcgcaagcccgacaccccgatgacgctcaccgtcgcc
gggaccaccacccgccagcggacctgggaggcgacgctcggcaccgtcgcgcaggtcctc
aagcaggccaaggtgctgccctcgcccgacggcggccgtccggtcatagccgtggtcggt
gagcactgcgccccggcccgccgcgaccagctctcctggttcgagtcgaagccactcttc
ggctggaaggtcctggtgccgcgcaccaaggagcaggcggcctcgctctccgaccagctg
cgctcctacggcgcggtgccgcacgaggtgccgaccatcgccgtcgagccgccgcgcacc
ccgcagcagatggaacgggccgtcaagggcctggtcaccggacgctacgagtggatcgcg
ttcaccagcgtcaacgcggtcaaggcggtccgggagaagttcgaggagtacgggctcgac
gcgcgggccttcgccggcatcaaggtcgccgccgtcggcgagcagaccgcggccgcgctg
atcgccttcggcgtcaagcccgacctcgtcccctcgggcgagcagtccgcggccgggctc
ctggaggactggccgccgtacgacccggtcttcgacccgatcgaccgggtgttcctgccg
cgcgccgacatcgccaccgagaccctggtggccgggctgatcgagctgggctgggaggtg
gacgacgtcaccgcctaccggacggtgcgcgcctcgccgccgccggccgacacccgcgag
gcgatcaagggcggcggcttcgacgcggtcctgttcacctcgtcctcgaccgtccgcaac
ctggtcggcatcgcgggcaagccgcacaacgtcacgatcatcgcctgtatcgggcccgcc
accgccaagacggcggaggagcacgggctgcgcgtcgacgtgatggcgcccgagccctcg
gtgcacaagctggccgaggcgctcgcctccttcggcgcggagcgcagggccgccgcgctg
gaggccggggagagcgtcgcccggcccagcgagcggcgccccggcgcccggcgccgcagg
gccgcctcctcctcgtga

DBGET integrated database retrieval system