KEGG   Streptomyces albus: XNR_3855Help
Entry
XNR_3855          CDS       T02545                                 

Definition
Glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
salb  Streptomyces albus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XNR_3855
   00330 Arginine and proline metabolism
    XNR_3855
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    XNR_3855
Enzymes [BR:salb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     XNR_3855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4380989..4382275
Genome map
AA seq 428 aa AA seqDB search
MRSPIPEYLDEVLRTCAGDRAGAVADYVPELAAADAEQLAVAVSAVDGTVYEAGDSRTSF
TIQSISKPFTYALALADRGYEAVLAKIGVEPSGEAFNELSLEEGSARPRNPMINVGALAA
HTLAGPPGASRAERFERVVSGISAFAGRRLEIDEAVCRSEMETAHRNLAIAHMLRSYEVI
EEDAPHVVEDYVRQCSLLVTTRDLALMAATLANGGVQPVTGEQVVSRDVVRQVLSVMTTC
GMYDAAGDWVTTVGIPAKSGVSGGILGVLSGQVGIGVFSPRLDRHGNSVRGVRVCERLSA
DMGLHMMDAPAPARSVLRGGRVLHGPASRTALVYELQGTIQFAGAERLVHGIAHTPPGHN
EVALDLTRVYSINPVARRMILETVRRLTHDGHAVTLIDPDRVLSDPVAGDGIRPRVVDTW
EWGEAPAT
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgcggtcaccgatccccgagtacctggacgaggtcctccggacctgcgcgggcgaccgg
gcgggagccgtcgccgactacgtaccggagctggccgccgccgacgccgagcagctcgcc
gtcgcggtctcggcggtcgacggcaccgtctacgaggcgggcgacagccgcacctccttc
accatccagtcgatctccaaacccttcacctacgccttggccctcgccgaccggggctac
gaggcggtcctcgccaagatcggggtggagccctcgggcgaggcgttcaacgagctgtcg
ctggaggagggctcggcccgcccccgcaacccgatgatcaacgtcggcgccctggccgcc
cacaccctcgcgggcccgcccggggcgtcgcgtgcggagcggttcgagcgggtcgtctcc
ggcatctccgccttcgccgggcggcggctggagatcgacgaggccgtctgccgctccgag
atggagaccgctcaccgcaatctcgccatcgcccacatgctgcgcagctacgaggtcatc
gaggaggacgccccgcacgtcgtcgaggactacgtccggcagtgctcgctgctggtcacc
acccgagatctggccctgatggccgccaccctcgccaacggcggcgtgcagccggtcacc
ggcgagcaggtggtgagccgcgacgtggtccgccaggtcctcagcgtcatgaccacctgc
ggcatgtacgacgcggccggcgactgggtgaccaccgtcggcatccccgccaagagcggc
gtctccggcggcatcctcggcgtgctctcgggacaggtcggcatcggcgtcttctcgccg
cgcctggaccggcacggcaacagcgtgcgcggcgtccgcgtctgcgaacggctctccgcc
gacatgggcctgcacatgatggacgctccggccccggcccgctcggtcctgcgcggcggc
cgtgtcctgcacggcccggccagcaggacggcgctcgtctacgaactccagggcaccatc
cagttcgcgggcgccgaacgcctcgtgcacggcatcgcccacaccccgcccggccacaac
gaggtggccctcgatctcacccgggtgtactccatcaacccggtcgcccgccggatgatt
ctggaaacggtccgccgcctcacccacgacggccacgccgtcaccctgatcgacccggac
cgcgtcctgtccgacccggtcgcgggcgacggaatccggcctcgcgtcgtcgacacctgg
gaatggggcgaggcacccgccacctga

DBGET integrated database retrieval system