KEGG   Streptomyces albus: XNR_3979Help
Entry
XNR_3979          CDS       T02545                                 

Definition
Thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
salb  Streptomyces albus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:salb00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4525252..4526529
Genome map
AA seq 425 aa AA seqDB search
MDVISVIRAKRDRIPLTDAQIDWTVDAYTRGAVADEQMSALAMAILLNGMDRREIARWTA
AMIASGERLDFSSLARPTADKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRASLSNAELLDVLASTGAVICAAGDGLAPADKKLYALRDVTGTVEAIPLI
ASSIMSKKIAEGTGSLVLDVKCGTGAFMKTVEDARELAETMVSLGTDHGVKTVALLTGMS
TPLGLTAGNALEVRESVEVLAGGGPADVVELTLALARDMLEAAGIHDADPAKKLVDGSAM
DVWRRMISAQGGDPDAPLPTARHTHTVTAPATGVLSRLDAYDVGVAAWRLGAGRARKEDP
VQAAAGIELHAKPGDTVTEGAPLLTLHTDTDERFAGALDALGSAWDIAAPGTTVDTPPIV
LDRIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcatctcggtcatccgcgccaagcgcgaccgcatccccctcaccgacgcccag
atcgactggacggtcgacgcctacacgcgcggcgccgtcgccgacgagcagatgtccgcg
ctggccatggcgatcctgctgaacggcatggaccgccgcgagatcgcccgctggaccgcc
gccatgatcgcctccggcgagcgcctcgacttctcctcgctggcccgccccaccgccgac
aagcactccaccggcggcgtcggcgacaagatcaccctgccgctcgccccgctcgtcgcg
gcctgcggcgccgccgtgccgcagctcagcgggcgcggcctcggccacaccggcggcacc
ctcgacaagctggagtccatccccggctggcgcgcctcgctcagcaacgccgaactcctc
gacgtcctcgcctccaccggcgccgtcatctgcgccgccggcgacggcctggcccccgcc
gacaagaagctgtacgcgctgcgcgacgtcaccggcaccgtcgaggccatcccgctgatc
gcctcctcgatcatgtcgaagaagatcgccgagggtaccggctccctcgtcctggacgtg
aagtgcggcaccggcgccttcatgaagaccgtcgaggacgcccgcgaactggccgagacc
atggtctccctcggcaccgaccacggcgtgaagacggtcgccctgctcaccggcatgtcg
acgccgctcggcctgaccgcgggcaacgccctggaggtccgcgaatcggtcgaggtgctg
gccggcggcggccccgccgacgtggtcgaactgaccctcgccctcgcccgggacatgctg
gaggcggccggcatccacgacgccgacccggcgaagaagctcgtcgacggctccgccatg
gacgtctggcgccgcatgatctccgcccagggcggcgacccggacgccccgctgcccacc
gcccgccacacccacaccgtcaccgcccccgccaccggcgtcctctcccgcctcgacgcc
tacgacgtcggcgtcgccgcctggcggctcggcgcgggtcgcgcccgcaaggaggacccg
gtgcaggccgccgccggcatcgagctgcacgccaagccgggcgacacggtcaccgagggc
gcgcccctgctgaccctgcacaccgacaccgacgagcggttcgcgggcgccctcgacgcg
ctcggctccgcctgggacatcgccgcgccgggcaccaccgtcgacaccccgccgatcgtc
ctggaccgcatcgcctga

DBGET integrated database retrieval system