KEGG   Streptomyces albus J1074: XNR_4064Help
Entry
XNR_4064          CDS       T02545                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
salb  Streptomyces albus J1074
Pathway
salb00220  Arginine biosynthesis
salb00250  Alanine, aspartate and glutamate metabolism
salb00290  Valine, leucine and isoleucine biosynthesis
salb01100  Metabolic pathways
salb01110  Biosynthesis of secondary metabolites
salb01130  Biosynthesis of antibiotics
salb01210  2-Oxocarboxylic acid metabolism
salb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XNR_4064
   00290 Valine, leucine and isoleucine biosynthesis
    XNR_4064
   00220 Arginine biosynthesis
    XNR_4064
Enzymes [BR:salb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     XNR_4064
    2.6.1.66  valine---pyruvate transaminase
     XNR_4064
Amino acid related enzymes [BR:salb01007]
 Aminotransferase (transaminase)
  Class I
   XNR_4064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGI90399
UniProt: D6B2L0
Position
complement(4607489..4608700)
Genome map
AA seq 403 aa AA seqDB search
MQVIQSTKLANVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPAAFGFECPPEILEDILRN
VGSAHGYGDAKGLLAARRAVMMHYQTLGVETDVEHVFMGNGVSELITMAMQGLLDDGDEV
LVPAPDYPLWTASVSLAGGTAVHYRCDEESDWMPDLADIERKITDRTKALVIINPNNPTG
AVYSDEMLRSLTDIARRHNLLVCSDEIYDKILYDGATHTPTAAFAPDLLTLTFNGMSKAY
RVAGYRSGWLAISGPKAHAQSYIEGLNILANMRLCANMPAQHGVVAALTGRQTIQDLVLP
GGRLLEQRDAAYDLLTQIPGVTCVKPKGALYLFPRLDPKVFKIKDDRQMILDLLRQERIM
CVQGTGFNWPEPDHFRIVTLPAAEDLKEAVTRIGHFLDGYSQP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgatccagtccacgaagctcgccaacgtctgttacgagatccggggtccggtg
ctggaggaggcgatgcggctggaggcagccggccaccgcatcctcaagctcaacacgggc
aacccggcggcgttcggtttcgagtgcccgcccgagatcctggaggacatcctccgcaac
gtcggctccgcccacgggtacggcgacgcgaaggggctgctcgcggcacgccgcgcggtg
atgatgcactaccagacgctgggcgtggagaccgacgtcgagcacgtcttcatgggcaac
ggcgtctccgagctgatcaccatggcgatgcagggcctcctcgacgacggcgacgaggtc
ctcgtcccggcccccgactacccgctgtggaccgcctcggtctcactggcgggcggtacg
gcggtgcactaccggtgcgacgaggagtcggactggatgccggacctggccgacatcgag
cggaagatcaccgaccgcaccaaggccctggtcatcatcaacccgaacaacccgaccggc
gccgtctacagcgacgagatgctgcgctcgctcaccgacatcgcccgccgccacaacctg
ctggtctgctccgacgagatctacgacaagatcctctacgacggcgccacccacaccccg
accgccgccttcgccccggacctgctgacgctgaccttcaacggcatgtccaaggcgtac
cgcgtggccggttaccgctcgggctggctggccatctcgggcccgaaggcgcacgcccag
tcgtacatcgagggcctgaacatcctcgccaacatgcggctctgcgccaacatgccggcc
cagcacggcgtggtcgcggcgctcaccgggcggcagaccatccaggacctggtgctgccc
ggcggccgccttctggagcagcgcgacgccgcgtacgacctgctgacccagatccccggc
gtcacctgcgtgaagccgaagggcgcgctctacctcttcccgcgcctggacccgaaggtc
ttcaagatcaaggacgaccggcagatgatcctcgacctgctgcgccaggagcggatcatg
tgcgtacaggggacggggttcaactggccggaacccgaccacttccgcatcgtgaccctg
ccggcggcggaggacctcaaggaggccgtgacccgcatcgggcacttcctcgacgggtac
agccagccctga

DBGET integrated database retrieval system