KEGG   Streptomyces albus: XNR_4294Help
Entry
XNR_4294          CDS       T02545                                 

Definition
4-alpha-glucanotransferase (amylomaltase) (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
salb  Streptomyces albus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:salb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4881561..4883855
Genome map
AA seq 764 aa AA seqDB search
MALSRLAELHGVATSYSPSPDRTVPAAESAVVAALAALGVDASSPEAIRAALEKAEAGQA
ARLLPPTVVLRSAAPSADPRTAPELAALPPGTRVRLTRDPDPVPARPAPAGGRDAGEAVR
RAAPVGEAPPPAWNWTVPLVPAATAPPPPAGSALPPAADVLWAVPFGVHRIEATTPDGRT
ATSHLVIAPDHIRGPESRAWGLLVQLYSLLSHRSWGMGDLGDLAELATWAGRVHGAGFVQ
VNPLHAAVPGTPTDPSPYRPSSRRFPDPVHLRVEAIPEYTALSADVRPHLDGLLRRAAEL
RGRVLSGEALIDRDAVWELKREALERLCAVPLPPGRQAAYEDFTAAHGQALTDHATWAAL
TERHGPHWSEWPAPLTDPRSRQTAAARTELAARVDFHRRLAWYTDTQLAEAQRAAREAGM
AVGLVHDLAVGVHPDGSDAWSQQDVFAAGMSVGAPPDAFNALGQDWGLPPWRPDRLAESG
YAPYRGLLRSLLRNAGALRIDHVMGLFRLWWVPVGAPPTDGTYVHYDAEAMLAVLALEAH
RADAVVIGEDLGTVEPGVRETLQRHGVLGTSVLWFERDWDGTGLPLPAEAWRASCVATAT
THDLPSTASRLTGDHVRLRHRLGLLTRPLAEEEAEEAAATATWLTVLDGLGLMGAAPGGH
LPGAAPDEEAAVLAVHRFLLRTPARMIGVWLPDGTGDRRPQNLPGTWDQYPNWRLPVADA
QGHPVTLEQLTASPRVARLLRTVATEDQTPAPMVRTAPPDARPV
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
ttggccctgtcccggctcgccgaactccatggtgtcgccacctcttactccccctccccg
gaccgcaccgttccggccgccgaatccgccgtcgtggccgccctggccgccctcggcgtc
gacgcgagcagccccgaagcgatccgggccgccctggagaaagccgaagccggacaggcc
gcccgcctgctgccgcccaccgtggtgctccggtccgccgccccgtcggccgacccgcgc
accgcgcccgagctggcggcactgcccccgggcacccgggtccgcctgacccgcgacccc
gaccccgtcccggcccggcccgcccccgcgggcggccgggacgcgggcgaggcggtccgc
cgcgccgcccccgtcggcgaggccccgccgcccgcctggaactggaccgtccccctggtc
ccggccgccaccgcgcccccgccccccgccggcagcgccctccctcccgccgccgacgtg
ctgtgggccgtaccgttcggcgtccaccggatcgaggccaccacgcccgacggacgcacc
gccaccagccacctcgtcatcgccccggaccacatccgcgggcccgagtcccgcgcctgg
ggcctgctcgtccagctctactcgctgctctcgcaccgctcctggggcatgggcgacctc
ggcgacctcgccgaactcgccacctgggccggacgcgtgcacggcgccggattcgtccag
gtcaaccccttgcacgcggccgtccccggcacgcccaccgacccctccccgtaccggccg
tcctcccgccgcttccccgacccggtgcacctgcgcgtcgaggcgatccccgagtacacc
gcgctcagcgccgacgtccgcccgcacctcgacgggctgctgcgccgcgccgccgaactg
cgcggccgggtcctctccggtgaggccctcatcgaccgcgacgccgtctgggagctgaag
cgcgaggcgctcgaacgcctctgcgccgtccccctcccgccgggccgccaggccgcctac
gaggacttcaccgccgcccacggccaggccctcaccgaccacgccacctgggccgccctc
accgaacgccacggcccgcactggtccgagtggcccgcccccctcaccgacccgcgctcc
cggcagacggccgccgcgcgcaccgaactcgccgcccgcgtcgacttccaccgccgcctc
gcctggtacaccgacacccagctcgccgaggcccagcgcgccgcccgcgaggccgggatg
gccgtcggcctcgtccacgacctggccgtcggcgtccaccccgacggctccgacgcctgg
tcccagcaggacgtcttcgccgccggcatgtcggtcggcgcgccccccgacgccttcaac
gccctcggccaggactggggcctgccgccctggcgccccgaccgcctcgccgagagcggc
tacgccccctaccgcggcctcctccgctccctgctgcgcaacgccggtgccctgcgcatc
gaccacgtcatgggcctcttccgcctctggtgggtcccggtcggcgccccgcccaccgac
ggcacctacgtccactacgacgccgaggccatgctcgccgtcctcgccctggaggcccac
cgcgccgacgccgtcgtcatcggcgaggacctcggcaccgtcgaaccgggcgtccgcgag
accctccagcggcacggcgtcctcggcacctccgtcctctggttcgagcgcgactgggac
ggcaccgggctgccgctgcccgccgaggcgtggcgtgcctcctgcgtcgccaccgccacc
acccacgacctgccctccaccgcctcccgcctcaccggcgaccacgtccgcctccgccac
cgcctcggcctcctcacccgccccttggccgaggaggaggccgaggaggcagccgccacc
gccacctggctcaccgtcctcgacggcctcggcctgatgggcgcggcccccggcggccac
ctgcccggggccgcccccgacgaggaggccgccgtcctcgccgtccaccgcttcctgctc
cgcaccccggcccgcatgatcggcgtctggctccccgacggcaccggcgaccgccgcccc
cagaacctcccgggcacctgggaccagtaccccaactggcggctccccgtcgccgacgcc
cagggacaccccgtcaccctcgaacaactgaccgcctccccgcgcgtggcccgcctgctg
cgcaccgtcgccaccgaggaccagacacccgcccccatggtccgtacggcacccccggac
gcgcggcccgtctag

DBGET integrated database retrieval system