KEGG   Streptomyces albus: XNR_4350Help
Entry
XNR_4350          CDS       T02545                                 

Definition
Glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
salb  Streptomyces albus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XNR_4350
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XNR_4350
Enzymes [BR:salb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     XNR_4350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4960004..4961080
Genome map
AA seq 358 aa AA seqDB search
MKVGSSSLTTASGGLDADRVDALVDVLAKARSGGTREIVLVSSGAIAAGLAPLGFPRRPR
DLARQQAAASVGQGLLVARYTASFARYGVRVGQVLLTGDDTSRRAHYRNAYRTLDQLLTL
GALPVVNENDTVATDEIRFGDNDRLAALVAHLVRADLLVLLSDVDGLYDGDPARPTSSRI
QNVHGPEDLEGVEIGSAGKAGVGTGGMVTKVEAAQIAANAGIDVVLTSASQAADALAGHP
TGTHFHQRGRRSAGRLLWLQHASTPKGALILDDGAVRAVVERRTSLLPAGVEAVEGEFTA
GDPVELRDATGRAVARGLVNFDATEIPRLLGRSTRDLARELGPAYEREIVHRDDLVLL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcggctcctcctcgctgaccaccgcgtcaggagggctcgacgccgaccgcgtc
gacgccctggtcgacgtcctcgcgaaggcccgctccggcggcacccgcgagatcgtcctc
gtctcctccggcgccatcgccgccggcctcgccccgctcggcttcccgcgccgcccccgc
gacctcgcccgccagcaggccgccgccagcgtcggccagggcctgctcgtcgcccgctac
accgcctccttcgcgcggtacggcgtccgcgtgggccaggtgctgctcaccggcgacgac
accagccgccgcgcccactaccgcaacgcctaccgcaccctcgaccagctgctcaccctc
ggcgcgctccccgtcgtcaacgagaacgacaccgtcgccaccgacgagatccgcttcggc
gacaacgaccggctcgccgccctcgtcgcccacctggtccgcgccgacctgctggtcctc
ctctccgacgtggacggcctctacgacggcgaccccgcccgccccaccagctcccgcatc
cagaacgtgcacgggcccgaggacctcgaaggcgtcgagatcggcagcgcgggcaaggcc
ggggtcggcaccggcggcatggtcaccaaggtcgaggcggcccagatcgccgccaacgcc
ggcatcgacgtcgtcctcacctccgccagccaggccgccgacgccctcgccggacacccc
accggcacccacttccaccagcgcggccgccgctccgccgggcgcctcctctggctccag
cacgcctccacccccaagggcgccctcatcctcgacgacggggccgtccgcgccgtcgtc
gagcggcgcacctcgctgctgcccgccggggtcgaggcggtcgagggggagttcaccgcc
ggcgacccggtcgagctgcgcgacgccaccggacgcgccgtcgcccgcggcctcgtcaac
ttcgacgccaccgagatcccccgtctgctcggccgctccacccgcgacctcgcccgggaa
ctggggcccgcctacgaacgcgagatcgtccaccgcgacgacctggttctcctctag

DBGET integrated database retrieval system