KEGG   Streptomyces albus J1074: XNR_4350Help
Entry
XNR_4350          CDS       T02545                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
salb  Streptomyces albus J1074
Pathway
salb00330  Arginine and proline metabolism
salb00332  Carbapenem biosynthesis
salb01100  Metabolic pathways
salb01130  Biosynthesis of antibiotics
salb01230  Biosynthesis of amino acids
Module
salb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XNR_4350
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    XNR_4350
Enzymes [BR:salb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     XNR_4350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGI90678
Position
4960004..4961080
Genome map
AA seq 358 aa AA seqDB search
MKVGSSSLTTASGGLDADRVDALVDVLAKARSGGTREIVLVSSGAIAAGLAPLGFPRRPR
DLARQQAAASVGQGLLVARYTASFARYGVRVGQVLLTGDDTSRRAHYRNAYRTLDQLLTL
GALPVVNENDTVATDEIRFGDNDRLAALVAHLVRADLLVLLSDVDGLYDGDPARPTSSRI
QNVHGPEDLEGVEIGSAGKAGVGTGGMVTKVEAAQIAANAGIDVVLTSASQAADALAGHP
TGTHFHQRGRRSAGRLLWLQHASTPKGALILDDGAVRAVVERRTSLLPAGVEAVEGEFTA
GDPVELRDATGRAVARGLVNFDATEIPRLLGRSTRDLARELGPAYEREIVHRDDLVLL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcggctcctcctcgctgaccaccgcgtcaggagggctcgacgccgaccgcgtc
gacgccctggtcgacgtcctcgcgaaggcccgctccggcggcacccgcgagatcgtcctc
gtctcctccggcgccatcgccgccggcctcgccccgctcggcttcccgcgccgcccccgc
gacctcgcccgccagcaggccgccgccagcgtcggccagggcctgctcgtcgcccgctac
accgcctccttcgcgcggtacggcgtccgcgtgggccaggtgctgctcaccggcgacgac
accagccgccgcgcccactaccgcaacgcctaccgcaccctcgaccagctgctcaccctc
ggcgcgctccccgtcgtcaacgagaacgacaccgtcgccaccgacgagatccgcttcggc
gacaacgaccggctcgccgccctcgtcgcccacctggtccgcgccgacctgctggtcctc
ctctccgacgtggacggcctctacgacggcgaccccgcccgccccaccagctcccgcatc
cagaacgtgcacgggcccgaggacctcgaaggcgtcgagatcggcagcgcgggcaaggcc
ggggtcggcaccggcggcatggtcaccaaggtcgaggcggcccagatcgccgccaacgcc
ggcatcgacgtcgtcctcacctccgccagccaggccgccgacgccctcgccggacacccc
accggcacccacttccaccagcgcggccgccgctccgccgggcgcctcctctggctccag
cacgcctccacccccaagggcgccctcatcctcgacgacggggccgtccgcgccgtcgtc
gagcggcgcacctcgctgctgcccgccggggtcgaggcggtcgagggggagttcaccgcc
ggcgacccggtcgagctgcgcgacgccaccggacgcgccgtcgcccgcggcctcgtcaac
ttcgacgccaccgagatcccccgtctgctcggccgctccacccgcgacctcgcccgggaa
ctggggcccgcctacgaacgcgagatcgtccaccgcgacgacctggttctcctctag

DBGET integrated database retrieval system