KEGG   Streptomyces albus: XNR_4757Help
Entry
XNR_4757          CDS       T02545                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
salb  Streptomyces albus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5408760..5409548)
Genome map
AA seq 262 aa AA seqDB search
MPVLPGAEPYRHDGGPTGVLLCHGFTGTPQSMRPWAEDLAARGHTVSLPLLPGHGTRWED
LQLTGWQDWYAEVDRALGELLARCERVYVAGLSMGGALALRLAARHGDAVRGVVVVNPAN
KVHGLSAYALPAARHLVRTTKGLVSDIALEGSEEVGYHRVPLHAAHSLRNFFRLVDAELP
QVTQPLLLLRSPRDHVVPPADSARVLGRVSSRDVTEILLQNSFHVATLDHDAPRVFEESA
AFLARTGADGADSRPEGEAVSG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgccggtcctgcctggagccgaaccgtaccgccacgacggcggccccacgggtgtcctc
ctctgccacggcttcaccggaacaccccagtcgatgcgcccctgggccgaggacctcgcc
gcccgcggccacaccgtctccctgccgctcctccccggccacggcacccgctgggaagac
ctccagctcaccggctggcaggactggtacgcggaggtcgaccgggccctcggcgaactc
ctggcccgctgcgagcgggtctacgtcgccgggctctcgatgggcggcgcgctggccctg
cggctggccgcccggcacggggacgcggtgcgcggcgtggtcgtcgtcaacccggccaac
aaggtgcacggcctgagcgcctacgcgctgcccgccgcccgccacctggtgcgcaccacc
aagggcctggtctccgacatcgccctggagggctccgaggaggtcggctaccaccgggtg
ccgctgcacgccgcgcactccctgcggaacttcttccggctggtcgacgcggagctgccg
caggtcacccagccgctgctgctcctgcgcagcccccgcgaccacgtggtgccgcccgcc
gactcggcgcgggtgctggggcgggtctcctcgcgggacgtgacggagatcctgctccag
aacagcttccacgtggcgacactggaccacgacgccccgcgcgtcttcgaggagagcgcc
gccttcctcgcccgcaccggggcggacggggcggacagcaggccggaaggggaggccgtc
agtggctga

DBGET integrated database retrieval system