KEGG   Streptomyces albus: XNR_4811Help
Entry
XNR_4811          CDS       T02545                                 

Definition
secreted alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
salb  Streptomyces albus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XNR_4811
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    XNR_4811
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XNR_4811
Enzymes [BR:salb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     XNR_4811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5472717..5474363)
Genome map
AA seq 548 aa AA seqDB search
MTSRTEHHPRPAAPSRRTVVLAAAATGALLPLGAATTATAAATPRFLHGVASGDPLPDGV
LLWTRVTPTEEAQPGSGAGPDTEVGWEIAADAAFSSVVARGTVTARAATDHTVKADVRGL
SPATGYWFRFTAGSTVSPTGRTRTAPAASASPAGLRFGVVSCANWEAGWFSAYRHLAARG
DLDAVLHLGDYIYEYATGDYPATPVRPHRPAHEITTLADYRLRHATYKTDPDLAALHARH
PVIAIWDDHEFANDAWSGGAENHTPGAEGAWSERSAAARQAYFEWMPVRASTEGTVFRRL
RFGDLADLHLLDLRSFRSEQVSIGNGAVDSPDRSITGRAQLDWLKAGLSGSQAAWQLVGT
SVMISPVAFGSVPAHLLKPLAELLGLPTQGLAINVDQWDGYTADRTELIRHLRSAGIRDT
VFLTGDIHMAWANDVPVTAATYPLSESAATEFVVTSVTSDNLDDLLKVAPGTLSTVAEGA
IKAANRHVKWLDMDGHGFGVLDVTAERSQMDYYLLSDRADPGATASWLRSYRTRRGTQRV
ERADAPVA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtcgaaccgagcaccaccccagacccgcggcccccagccgccgcaccgtcgtc
ctggcggccgccgccaccggcgccctgctcccgctgggcgcggccaccaccgccaccgcc
gcggccaccccgcggttcctgcacggcgtggcctcgggcgacccgctgcccgacggcgtc
ctgctctggacccgcgtcacccccaccgaggaggcgcagccgggctccggcgcgggcccg
gacaccgaggtcggctgggagatcgccgccgacgccgccttctcctcggtcgtcgcccgc
ggcaccgtcaccgcgcgggccgccaccgaccacaccgtcaaggccgacgtacgcgggctc
tccccggccaccggctactggttccgcttcacggccggctccaccgtctcgcccaccggc
cgcacccgtaccgcccccgccgcctcggcctccccggccgggctgcggttcggcgtggtc
tcctgcgccaactgggaggccggctggttctccgcctaccgccacctcgcggcccgcggc
gacctggacgccgtcctgcacctgggtgactacatctacgagtacgccaccggcgactac
ccggccacgcccgtccgcccgcaccgcccggcgcacgagatcaccaccctcgccgactac
cggctgcgccacgccacctacaagaccgaccccgacctggccgccctccatgcccgccac
ccggtcatcgccatctgggacgaccacgagttcgccaacgacgcctggtcgggcggggcg
gagaaccacacgcccggtgccgagggcgcgtggagcgagcggtcggcggcggcccggcag
gcgtacttcgagtggatgccggtccgcgcctccaccgagggcaccgtcttccggcggctg
cgcttcggcgacctcgccgacctgcacctgctggacctgcgcagtttccgctccgagcag
gtctccatcggcaacggcgcggtcgactccccggaccgcagcatcaccgggcgcgcccag
ctcgactggctcaaggcgggcctctccggctcgcaggccgcctggcagctggtcggcacc
tcggtgatgatctcgccggtcgccttcggctccgtcccggcccacctgctgaagccgctc
gccgaactcctcggcctgcccactcagggcctcgcgatcaacgtcgaccagtgggacggc
tacaccgccgaccgcaccgagctgatccgccacctgcggagcgccggcatccgcgacacc
gtcttcctcaccggcgacatccacatggcctgggccaacgacgtgccggtgacggcggcg
acgtacccgctctcggagtcggcggccaccgagttcgtcgtcacctcggtcacctccgac
aacctcgacgacctgctgaaggtcgcccccggcacgctgtcgacggtggccgagggcgcg
atcaaggccgccaaccggcacgtgaagtggctcgacatggacgggcacggcttcggcgtc
ctcgacgtgacggccgaacgctcccagatggactactacctgctctccgaccgggccgat
ccgggcgccacggcctcctggctccgctcgtaccgcacccggcgcggcacccagcgggtc
gaacgggcggacgcgccggtcgcctga

DBGET integrated database retrieval system