KEGG   Streptomyces albus: XNR_4976Help
Entry
XNR_4976          CDS       T02545                                 

Definition
Fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
salb  Streptomyces albus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    XNR_4976
Enzymes [BR:salb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     XNR_4976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5658034..5658756
Genome map
AA seq 240 aa AA seqDB search
MEKNRAHPGRPWRPQEDQAVAHAWHDLVETARATVRDGLVVGTSGNVSVRVTPDRPAGGT
GDLVLITPTGVPYDRLGPEDTVAVGLDGRQVLGTLKPTSELPLHLAVYRTGTARAVVHTH
APHATAVSTLVDTLPPVHYMAAALGGPVRTAPYALYGSQELAGHLVEALRDRTACLLRNH
GTVTTGDTLTQALDRTAQLEWMCRVWLLARSVPGHTPSLLDAGQLDAAAERLRGYGQPGG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaccgcgcccaccccggccgcccctggcgcccccaggaggaccaggccgtc
gcccacgcctggcacgacctcgtggagaccgcccgcgccaccgtccgcgacggactggtg
gtcggcacctccggcaacgtctcggtccgcgtcacccccgaccgcccggccggcgggacc
ggcgacctcgtcctcatcacccccaccggcgtcccctacgaccggctcggccccgaggac
accgtcgccgtcggcctcgacggccgccaggtgctcggcaccctgaagcccaccagcgag
ctccccctccacctcgccgtgtaccgcaccggcaccgcccgtgccgtcgtccacacccac
gccccgcacgccaccgccgtctccacgctcgtcgacaccctgccgccggtccactacatg
gccgccgcgctcggcggccccgtccgcaccgccccctacgccctctacggcagccaggaa
ctcgccggccacctcgtcgaggccctccgggaccgcaccgcctgcctcctgcgcaaccac
ggcaccgtcaccaccggcgacaccctcacccaggccctggaccgcaccgcccagctggag
tggatgtgccgcgtctggctgctcgcccgctccgtccccggccacaccccctccctcctc
gacgcgggacagctcgacgccgccgccgagcggctgcgcggctacggccagccgggcggg
tga

DBGET integrated database retrieval system