KEGG   Streptomyces albus: XNR_4976Help
Entry
XNR_4976          CDS       T02545                                 

Definition
Fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
salb  Streptomyces albus
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:salb00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5658034..5658756
Genome map
AA seq 240 aa AA seqDB search
MEKNRAHPGRPWRPQEDQAVAHAWHDLVETARATVRDGLVVGTSGNVSVRVTPDRPAGGT
GDLVLITPTGVPYDRLGPEDTVAVGLDGRQVLGTLKPTSELPLHLAVYRTGTARAVVHTH
APHATAVSTLVDTLPPVHYMAAALGGPVRTAPYALYGSQELAGHLVEALRDRTACLLRNH
GTVTTGDTLTQALDRTAQLEWMCRVWLLARSVPGHTPSLLDAGQLDAAAERLRGYGQPGG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaccgcgcccaccccggccgcccctggcgcccccaggaggaccaggccgtc
gcccacgcctggcacgacctcgtggagaccgcccgcgccaccgtccgcgacggactggtg
gtcggcacctccggcaacgtctcggtccgcgtcacccccgaccgcccggccggcgggacc
ggcgacctcgtcctcatcacccccaccggcgtcccctacgaccggctcggccccgaggac
accgtcgccgtcggcctcgacggccgccaggtgctcggcaccctgaagcccaccagcgag
ctccccctccacctcgccgtgtaccgcaccggcaccgcccgtgccgtcgtccacacccac
gccccgcacgccaccgccgtctccacgctcgtcgacaccctgccgccggtccactacatg
gccgccgcgctcggcggccccgtccgcaccgccccctacgccctctacggcagccaggaa
ctcgccggccacctcgtcgaggccctccgggaccgcaccgcctgcctcctgcgcaaccac
ggcaccgtcaccaccggcgacaccctcacccaggccctggaccgcaccgcccagctggag
tggatgtgccgcgtctggctgctcgcccgctccgtccccggccacaccccctccctcctc
gacgcgggacagctcgacgccgccgccgagcggctgcgcggctacggccagccgggcggg
tga

DBGET integrated database retrieval system