KEGG   Salinarchaeum sp. Harcht-Bsk1: L593_01440Help
Entry
L593_01440        CDS       T02693                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
sali  Salinarchaeum sp. Harcht-Bsk1
Brite
Enzymes [BR:sali01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     L593_01440
Transfer RNA biogenesis [BR:sali03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    L593_01440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
292169..293872
Genome map
AA seq 567 aa AA seqDB search
MSTGDGFEQACEELVERVLAGELERDDVESAKLEVCSKYSASKVPKHTELLDRAPDGRRD
ELAEVLHRKPVRTASGVSPVAIMTSPAPCPHGKCLYCPGGPDSEFESSQSYTGLEPAAAR
GEQNDYDPYGQVTLRLNQLREIGHPVDKVELILMGGTMTARSHDYQEWFVKEALRAMNDF
DPDAEPNPAEDESFAPERPAARDRSVARTPGEYHYTEDVIARNETGDVRAIGITFETKPD
WCDPEQVNRMLRLGGTKVEVGVQTTFERINREMHRGHGMEAAVSANRRLRDAGFKVGFHM
MPGQPGASKEMVLEDFRRLVERPEWRPDYLKIYPTLIVEDTVTYDMFRRGEFEPLGNDEA
AELVAEIKSMLPRYTRLQRVQRDIPATIIEGGVWKSNLRQLARQRMDEHGWTCDCIRCRE
VGMNDEVPESPELRVDTYEVAGGTEHFCSIEDFDRDLLIGFCRLREPGDPIRRELQDAAI
IRELHVYGSELGIGEPGGTEDDAAQADEADAGFQHQGHGRRLVERAESIARERGYEKLAV
IAGIGAREYYREQLGYRQDGPYVSKRL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccggcgacggcttcgagcaggcctgtgaggaactggtcgagagagtcctcgcc
ggggaactcgagcgggacgacgtcgagtctgctaaactcgaggtctgctcgaagtactcc
gcctcgaaggtgcccaagcacacggagctgctcgaccgggcgcccgacggccgtcgggac
gaactggccgaagtgctgcaccgcaagcccgtccggacggcgtccggcgtttcgccggtc
gcgatcatgaccagtccggcgccctgcccacacgggaagtgcctctactgcccaggcggc
cctgactcggagttcgagtcgtctcagagctacaccgggttggagcccgccgcggcgcgc
ggcgagcagaacgactacgatccctacggccaggtcacgctccggctcaaccagcttcgg
gagatcggtcaccccgtggacaaggtcgagttgatcctcatgggcggaacgatgaccgcg
cggagccacgactatcaggagtggttcgtgaaggaggcgctgcgggcgatgaacgacttc
gatcccgacgccgagccgaatcccgccgaggacgagagcttcgcgcccgaacggccggct
gcacgcgaccgctcggtcgcccggactcccggcgagtaccactacacggaggacgtgatc
gcccggaacgagactggcgacgttcgcgcgatcggaatcacgttcgagacgaagcccgac
tggtgtgaccccgagcaggtgaaccggatgctccgtctcggcggcacgaaggtcgaggtc
ggggtgcagaccaccttcgagcggatcaaccgcgagatgcaccgcgggcacggcatggag
gccgcggtgtcggcgaaccggcggctacgcgacgccgggttcaaggtcggcttccacatg
atgccggggcagcccggtgcatccaaggagatggtactggaggacttccgccgactcgtc
gagcggccggagtggcgcccggactacctcaagatctacccgacgctgatcgtcgaggac
accgtcacgtacgacatgttccgtcgcggcgagttcgagcccctcgggaacgacgaggcc
gccgaactcgtcgcggagatcaagtcgatgctgccccggtacacccgcctccagcgggtc
cagcgcgacatcccggcgacgatcatcgagggcggcgtctggaagtcgaacctgcgccag
ctcgcacgacagcggatggacgagcacggctggacctgcgactgcatccgctgtcgcgag
gtcgggatgaacgacgaggtgccggaatccccagagcttcgcgtcgacacctacgaggtc
gcaggcgggaccgagcacttctgctccatcgaggacttcgatcgcgacctcctgatcggc
ttctgccggctccgcgaaccgggcgatccgatccgtcgcgagctacaggacgcggccatc
attcgggagctccacgtgtacgggagcgaactcggcatcggcgagcccggaggcaccgag
gacgatgccgcgcaggcggacgaggccgacgctggcttccagcaccaggggcacggtcgg
cgcctcgtcgagcgcgccgagtccatcgcgcgggagcgcggctacgagaagctggccgtc
attgccggcatcggcgcacgcgagtactaccgcgagcaactcggctatcgccaggacggc
ccctacgtctcgaagcgtctctga

DBGET integrated database retrieval system