KEGG   Salinarchaeum sp. Harcht-Bsk1: L593_02525Help
Entry
L593_02525        CDS       T02693                                 

Definition
sugar kinase, ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sali  Salinarchaeum sp. Harcht-Bsk1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sali00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    L593_02525
Enzymes [BR:sali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     L593_02525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(526381..527256)
Genome map
AA seq 291 aa AA seqDB search
MARVLVAGHVNLDVTLLVDRLPAADEEAAIQERVRSGGGSAANVATGLARLGVDARLLGS
VGDDEPGRRVRERLGEHGVDVDPVVEAPGETSTKYLLVADEDVAMLGNDGVNEAVAPADL
APGTVADVEHVHLTGQRADTAERLARLAVDAGCSVSLDPGRRAGDRALDGVADRADVVFG
TDREIAALYGDDPTAAAGSERLVVATSGAGGARCFLGDETRAHPGFDVDVADTSGAGDAF
VAGFLSIWLAADDLDEALAFGNACGAIASQRVGARTALDPDAVASFRDGSP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgtcctcgtggcggggcacgtcaacctggacgtcacgctcctcgtcgatcga
ctcccggccgccgacgaggaggcggcaatccaggagcgggtgcgaagcggcggtggcagc
gcggccaacgtcgcgaccgggctggcgcggctcggcgtcgacgcacgactgctcgggagc
gtcggcgacgacgaaccaggtcgacgcgttcgcgaacgcctcggcgagcacggcgtcgac
gtcgatcccgtcgtcgaagcgccgggtgagaccagcacgaagtacctgctcgtcgcggac
gaggacgtcgcgatgctcggcaacgatggcgtcaacgaggcggtcgcccccgccgatctg
gctcccggtaccgtcgccgacgtcgaacacgtccacctgacgggccagcgtgccgacacg
gccgagcgactcgcacggctcgccgtcgacgccggctgctccgtgagcctcgatcccggt
cgccgagcgggggatcgcgcgctggacggcgtggccgatcgcgccgacgtcgtgttcggc
accgaccgagagatcgcggcgctctacggagacgatccgacggcggccgcgggaagcgag
cggctcgtcgtcgccacgagcggggccggtggggcccggtgtttcctgggcgacgagacc
agggcccaccccgggttcgacgtcgacgtggcggacaccagcggcgctggggacgcgttc
gtcgccgggttcctctcgatctggttggcggcggacgacctcgacgaagcgctcgcgttc
gggaacgcgtgtggtgcgatcgcgagtcagcgcgtcggcgcgcgaacggccctcgatccc
gacgcggtcgcctcctttcgcgacgggtccccgtga

DBGET integrated database retrieval system