KEGG   Salinarchaeum sp. Harcht-Bsk1: L593_14625Help
Entry
L593_14625        CDS       T02693                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sali  Salinarchaeum sp. Harcht-Bsk1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sali00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    L593_14625
  Amino acid metabolism
   00330 Arginine and proline metabolism
    L593_14625
Enzymes [BR:sali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     L593_14625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3137372..3138232
Genome map
AA seq 286 aa AA seqDB search
MSDTVGTDDEVESVSAETADAARKLAADAERVVVKAGTNTLTDDESNLDVEKVAKLVDDV
NDLLERDREVLLVSSGAVGAGKGRVDYPNDTVEESQALSTVGQSQLMAEYSDSFDRYDRT
VAQILLTENDLEDTERFTNFTNTVETLLEWDVVPIINENDAVATEEIRIGDNDMLSSSVA
IGVGADLLVTLTDVGGVYTANPKEDDAAERIEVVGNNYAEVQQLVDRSSSATFGGIQTKV
HGAREVSEHEIPAIIAKSTEPDVLEQIVTGKPVGTLFVPTNGETDE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacagtcggaaccgacgacgaggtcgagtccgtgagtgccgaaacggcagac
gctgcccgcaaactcgccgccgacgcagagcgcgtggtcgtcaaggccgggacgaacacg
ctgaccgacgacgagtcgaacctcgacgtcgagaaggtggccaaactcgtcgacgacgtc
aacgacctgctcgaacgcgacagagaggtgctgctcgtgtcctcgggcgcggtcggcgca
ggcaagggccgcgtcgactaccccaacgacacggtggaggagtctcaggcgctctcgacg
gtcggccagtcacagttgatggcagagtactccgacagcttcgaccgctacgaccggacg
gtcgcacagattctcctcaccgagaacgacctcgaggacaccgagcggttcacgaatttc
acgaacaccgtcgagacgctcctcgagtgggacgtcgttccgatcatcaacgagaacgac
gccgtggccaccgaggagatccggatcggcgacaacgacatgctctcctcctcggtcgcg
atcggggtcggagcggatctgctcgtgacgctgaccgacgttggcggggtctacaccgcc
aatccgaaggaggacgacgccgccgagcgaatcgaggtcgtcggcaacaactacgccgag
gtccaacagctcgtcgaccggagttcctcggcgacgttcggcggcatccagacgaaagtc
cacggcgcacgcgaggtgagcgagcacgagatccctgcgatcatcgcgaagtcgacggag
cccgacgtcctcgaacagatcgtgacaggcaaacccgtgggcaccctgttcgttcccacg
aacggtgagaccgatgagtga

DBGET integrated database retrieval system