KEGG   Salinarchaeum sp. Harcht-Bsk1: L593_14625Help
Entry
L593_14625        CDS       T02693                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sali  Salinarchaeum sp. Harcht-Bsk1
Pathway
sali00330  Arginine and proline metabolism
sali00332  Carbapenem biosynthesis
sali01100  Metabolic pathways
sali01130  Biosynthesis of antibiotics
sali01230  Biosynthesis of amino acids
Module
sali_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sali00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    L593_14625
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    L593_14625
Enzymes [BR:sali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     L593_14625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Snf7 ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: AGN02861
UniProt: R4W2F2
Position
3137372..3138232
Genome map
AA seq 286 aa AA seqDB search
MSDTVGTDDEVESVSAETADAARKLAADAERVVVKAGTNTLTDDESNLDVEKVAKLVDDV
NDLLERDREVLLVSSGAVGAGKGRVDYPNDTVEESQALSTVGQSQLMAEYSDSFDRYDRT
VAQILLTENDLEDTERFTNFTNTVETLLEWDVVPIINENDAVATEEIRIGDNDMLSSSVA
IGVGADLLVTLTDVGGVYTANPKEDDAAERIEVVGNNYAEVQQLVDRSSSATFGGIQTKV
HGAREVSEHEIPAIIAKSTEPDVLEQIVTGKPVGTLFVPTNGETDE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacagtcggaaccgacgacgaggtcgagtccgtgagtgccgaaacggcagac
gctgcccgcaaactcgccgccgacgcagagcgcgtggtcgtcaaggccgggacgaacacg
ctgaccgacgacgagtcgaacctcgacgtcgagaaggtggccaaactcgtcgacgacgtc
aacgacctgctcgaacgcgacagagaggtgctgctcgtgtcctcgggcgcggtcggcgca
ggcaagggccgcgtcgactaccccaacgacacggtggaggagtctcaggcgctctcgacg
gtcggccagtcacagttgatggcagagtactccgacagcttcgaccgctacgaccggacg
gtcgcacagattctcctcaccgagaacgacctcgaggacaccgagcggttcacgaatttc
acgaacaccgtcgagacgctcctcgagtgggacgtcgttccgatcatcaacgagaacgac
gccgtggccaccgaggagatccggatcggcgacaacgacatgctctcctcctcggtcgcg
atcggggtcggagcggatctgctcgtgacgctgaccgacgttggcggggtctacaccgcc
aatccgaaggaggacgacgccgccgagcgaatcgaggtcgtcggcaacaactacgccgag
gtccaacagctcgtcgaccggagttcctcggcgacgttcggcggcatccagacgaaagtc
cacggcgcacgcgaggtgagcgagcacgagatccctgcgatcatcgcgaagtcgacggag
cccgacgtcctcgaacagatcgtgacaggcaaacccgtgggcaccctgttcgttcccacg
aacggtgagaccgatgagtga

DBGET integrated database retrieval system