KEGG   Streptomyces albulus: DC74_3572Help
Entry
DC74_3572         CDS       T03082                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
salu  Streptomyces albulus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:salu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    DC74_3572
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    DC74_3572
Enzymes [BR:salu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     DC74_3572
Lipid biosynthesis proteins [BR:salu01004]
 Desaturase
  First
   DC74_3572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
4079810..4080832
Genome map
AA seq 340 aa AA seqDB search
MTAGPNAVEESPMPLDVPAGSSASSPLPSATLGGEQRRSLEQITLLMFITVPFLALIAAV
PLAWGWGVSWLDLGLMTAMYFIGCHGITIGFHRYFTHGAFKAKRPLRIALAVMGSLAVEG
PLVRWVADHRRHHKFSDAEGDPHSPWRYGETVPALLKGLWWAHVGWMFDEEQTPQHKYAP
DLIKDRAIRTISRQFVLWTTVSLLIPPLVGGLVTWSWQGALTAFFWGSLVRVALLHHVTW
SINSICHAVGKRPFKSRDRSGNVWWLAVLSCGESWHNLHHADPTSARHGVLKGQLDSSAR
LIRWFELAGWAHDVRWPNAARIDARRQDGARGEEKAPLGA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctggtccgaacgccgtggaagagtcaccgatgccgctcgatgtgcccgccggt
tcttctgcctcctcccccctgccgtccgcgacgctgggcggcgagcagcgcagatcgctg
gaacagatcaccctgctgatgttcatcaccgtgccgttcctggccttgatcgccgcggtg
ccgctggcctggggctggggcgtgagctggctggacctcgggctgatgacggcgatgtac
ttcatcggttgtcacggcatcaccatcggcttccaccgctacttcacgcacggtgcgttc
aaggcgaagcgtccgctgcggatcgcgctcgcggtcatggggtcgctggcggtggagggg
ccgctggtccgctgggtcgccgaccaccgcaggcaccacaagttctccgacgcggagggt
gatccgcactcgccgtggcggtacggcgagaccgtcccggcgctgctgaagggcctgtgg
tgggcgcacgtcggctggatgttcgacgaggagcagacgccgcagcacaagtacgcgccc
gacctgatcaaggaccgggcgatccggacgatctcccgccagttcgtgctgtggaccacg
gtgtcgctgctgatcccgccgctggtcggcgggctggtgacgtggtcctggcagggcgcg
ctgaccgcgttcttctggggctccctggtccgggtggcgctgctgcaccacgtcacgtgg
tcgatcaactccatctgtcacgcggtcggcaagcgcccgttcaagtcccgggaccgctcc
ggcaacgtctggtggctggcggtgctctcctgcggcgagtcctggcacaacctgcaccac
gccgatccgacctccgcccggcacggggtcctgaagggccagctggactccagcgcccgg
ctgatccgctggttcgagctggccggctgggcgcacgacgtgcggtggccgaacgcggcg
cggatcgacgcccggcgccaggacggcgcccgaggcgaggagaaggccccgctgggggca
tga

DBGET integrated database retrieval system