KEGG   Streptomyces albulus: DC74_5568Help
Entry
DC74_5568         CDS       T03082                                 

Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
salu  Streptomyces albulus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DC74_5568
Enzymes [BR:salu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DC74_5568
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     DC74_5568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(6346813..6348540)
Genome map
AA seq 575 aa AA seqDB search
MIVNEPVPDTFEDTPAKDRDPDWFKRAVFYEVLVRSFQDSNGDGIGDLKGITAKLDYLQW
LGVDCLWLPPFFKSPLRDGGYDVADYTAVLPEFGDLADFVEFVDAAHQRGMRVIIDMVMN
HTSDQHPWFQESRTDPDGPYGDYYVWADDDKQYADARIIFVDTEVSNWTFDPVRKQYYWH
RFFSHQPDLNYENPAVQEEMISALRFWLDLGIDGFRLDAVPYLYAEEGTNCENLPASHAF
LKRVRAEIDAQYPDTVLLAEANQWPEDVVDYFGDYAVGGDECHMAFHFPVMPRIFMAVRR
ESRYPVSEILAKTPQIPSGCQWGIFLRNHDELTLEMVTDEERDYMYAEYAKDPRMRANIG
IRRRLAPLLDNDRNQIELFTALLLSLPGSPILYYGDEIGMGDNIWLGDRDAVRTPMQWTP
DRNAGFSSCDPGRLFLPTIMDPVYGYQVTNVEAAMSSPSSLLHWTRRMIEIRKQNPAFGL
GSYTELPSSNPAVLAYLRESPGKDGADDDLVLCVNNFSRFAQPTELDLQAFSGRHPVELI
GGVRFPAIGKLPYLLTLAGHGFYWFRLRRTAHHAG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgtcaatgagcccgttcccgacacgttcgaagacaccccggcgaaggaccgcgac
cccgactggttcaaacgggcggtcttctacgaggtgctggtccggtccttccaggacagc
aacggtgacggaatcggggacctcaagggcatcacggccaagctcgactacctgcagtgg
ctgggggtggactgcctctggttgccaccgttcttcaaatccccgctgcgcgacggcggc
tacgacgtcgcggactacaccgcggtgctccccgagttcggtgacctggccgacttcgtg
gagttcgtggacgccgcccaccagcgcgggatgcgggtcatcatcgacatggtgatgaac
cacaccagcgaccagcacccgtggttccaggagtcccgcaccgaccccgacggcccctac
ggcgactactacgtctgggccgacgacgacaagcagtacgccgacgcccggatcatcttc
gtcgacaccgaggtctccaactggaccttcgacccggtccgcaagcagtactactggcac
cgcttcttctcccaccagccggacctcaactacgagaacccggcggtccaggaggagatg
atctccgccctgcgcttctggctcgacctgggcatcgacggcttccggctggacgcggtg
ccgtacctctacgccgaggagggcaccaactgcgagaacctgccggcctcgcacgccttc
ctgaagcgggtgcgcgccgagatcgacgcgcagtacccggacaccgtgctgctggccgag
gcgaaccagtggccggaggacgtggtcgactacttcggcgactacgcggtcggcggcgac
gagtgccacatggccttccacttcccggtcatgccgcgcatcttcatggcggtccgccgg
gagtcgcgctacccggtctcggagatcctcgccaagacgccgcagatcccgtccggctgc
cagtggggcatcttcctgcgcaaccacgacgagctgaccctcgaaatggtcacggacgaa
gagcgcgactacatgtacgcggagtacgccaaggacccgcggatgcgcgccaacatcggc
atccgccggcggctggccccgctgctcgacaacgaccgcaaccagatcgagctgttcacc
gcgctgctgctgtcgctgcccggctcgccgatcctgtactacggcgacgagatcgggatg
ggcgacaacatctggctcggcgaccgggacgccgtgcgcaccccgatgcagtggaccccg
gaccgcaacgccggcttctcctcgtgcgaccccggccggctgttcctgccgaccatcatg
gacccggtctacggctaccaggtcaccaacgtcgaggccgcgatgagctcgccctcgtcg
ctgctgcactggacccgccggatgatcgagatccgcaagcagaaccccgccttcggactc
ggcagctacaccgagctgccgtcgtccaaccccgcggtgctcgcctacctccgggaatcc
ccgggcaaggacggcgccgatgacgacctggtgctgtgcgtgaacaacttctcgcggttc
gcgcagcccaccgagctggacctccaggcgttcagcggccgccatccggtggaactcatc
ggcggtgtccgcttccccgcgatcggcaagctgccgtacctgctgaccctggcgggccac
ggcttctactggttccggctccgcaggaccgcgcaccacgccggttag

DBGET integrated database retrieval system