KEGG   Streptomyces albulus: DC74_5775Help
Entry
DC74_5775         CDS       T03082                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
salu  Streptomyces albulus
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:salu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DC74_5775
   00650 Butanoate metabolism
    DC74_5775
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DC74_5775
   00280 Valine, leucine and isoleucine degradation
    DC74_5775
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DC74_5775
Enzymes [BR:salu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DC74_5775
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     DC74_5775
Amino acid related enzymes [BR:salu01007]
 Aminotransferase (transaminase)
  Class III
   DC74_5775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(6589976..6591325)
Genome map
AA seq 449 aa AA seqDB search
MTELSGGPALPQERRVVTAIPGPKSQELWARKQETVAAGVGAVLPVFVKRAGGGVLEDVD
GNSLIDFGSGIAVTSVGNSAEAVVRRAVAQLADFTHTCAMVTPYETYVEVCEQLAELTPG
DHAKKSALFNSGAEAVENAVKIARAYTKRQAVVVFDHGYHGRTNLTMALTAKNMPYKHGF
GPFAPEVYRVPLAYPYRWLTGPENCAQEAADQAITQITKQIGAENVAAIIIEPVLGEGGF
IEPAKGFLPAIANFAKENGIVFVADEIQSGFCRTGQWFACEDEGIVPDLITTAKGIAGGL
PLAAVTGRAEMMDAAHAGGLGGTYGGNPVACAAALGSIETMRELDLNAKAKRIEEVMKGR
LTAMQEKFDVIGEVRGRGAMIAIELVKSGSKDPNPEATSALAKACHQEGLLVLTTGTFGN
VLRFLPPLVIGEDLLNEGLDILETAFGTL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactgtccggaggccccgccctcccccaggagcgtcgcgtcgtcaccgcgatc
cccggccccaagtcgcaggagctgtgggcccgcaagcaggagaccgtggccgccggtgtc
ggcgcggtgctgcccgtcttcgtcaagcgcgcgggcggcggtgtcctggaggacgtggac
ggcaactccctgatcgacttcggctccggcatcgcggtgacctcggtcggcaacagcgcg
gaggccgtggtgcgccgggccgtcgcccagctcgccgacttcacccacacctgtgccatg
gtcacgccgtacgagacgtacgtcgaggtctgtgagcagctggccgagctgacgccgggc
gaccacgccaagaagtcggcgctgttcaactccggtgcggaggcggtcgagaacgccgtc
aagatcgcccgggcgtacaccaagcgccaggcggtcgtcgtgttcgaccacggctaccac
ggccggaccaacctgacgatggcgctgaccgcgaagaacatgccgtacaagcacggcttc
ggtccgttcgcgcccgaggtctaccgcgtgccgctggcctacccctaccgctggctgacc
ggtccggagaactgcgcgcaggaggccgccgaccaggcgatcacgcagatcaccaagcag
atcggcgccgagaacgtcgcggcgatcatcatcgagccggtgctcggtgagggcggcttc
atcgagccggccaagggcttcctcccggccatcgcgaacttcgcgaaggaaaacggcatc
gtcttcgtcgccgacgagatccagtccggtttctgccgcaccggccagtggttcgcgtgt
gaggacgagggcatcgtgccggacctcatcacgaccgccaagggcatcgcgggcggtctg
ccgctggcggccgtcaccggccgcgccgagatgatggacgccgcgcacgcgggcggcctg
ggcggcacctacggcggcaacccggtggcctgcgccgccgcgctcggctcgatcgagacc
atgcgcgagctggacctgaacgccaaggccaagcgcatcgaggaggtcatgaagggccgc
ctgaccgcgatgcaggagaagttcgacgtcatcggcgaggtccgcggccgcggcgcgatg
atcgcgatcgagctggtcaagtcgggttccaaggaccccaacccggaggccacctcggcg
ctcgccaaggcgtgccaccaggagggcctgctggttctgacgaccggtacgttcggcaac
gtgctgcgcttcctgccgccgctggtgatcggcgaggacctgctgaacgagggcctggac
atcctggagacggccttcggcacgctctga

DBGET integrated database retrieval system