KEGG   Streptomyces albulus: DC74_6457Help
Entry
DC74_6457         CDS       T03082                                 

Definition
aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
salu  Streptomyces albulus
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:salu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DC74_6457
   00650 Butanoate metabolism
    DC74_6457
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DC74_6457
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DC74_6457
Enzymes [BR:salu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DC74_6457
Amino acid related enzymes [BR:salu01007]
 Aminotransferase (transaminase)
  Class III
   DC74_6457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
7375432..7376745
Genome map
AA seq 437 aa AA seqDB search
MTSDAASLHARHQAVMPSWLSLYYDRPLELTHGEGRHVWDADGTRYLDFFGGILTTMTAH
ALPEVTKAISEQAGRLLHSSTLYLSRPMVELAERIAALSGIPDARVFFTTSGTEANDAAL
LLATTHRRSNQILAMRNSYHGRSFSTVGITGNQSWSPTSLSPLQTLYVHGGVRSRGPYAD
LDDAAYTAACVADLEDVLQQAAGGVAALIAEPVQGVGGFTAPPDGLYAAFREVLAREGIL
WISDEVQTGWGRTGEHFWGWQAHGENGPPDLLTFAKGIGNGMSIGGVVARAEIMNCLPAN
SISTFGGSPITMAAGLANLTYLLEHDLQGNARRVGGLLIERLRAVTAGLDMVREVRGRGL
MIGVELVRPGTDEPSPEAATGVLEAARERGLLVGKGGRGGASLRIAPPLTLTVAEAEHGA
ELLADALRWTQANLAPR
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtccgacgccgcaagcctgcacgcccgccaccaggccgtcatgccgtcctggttg
agcctctactacgaccgccccctggagctcacccacggcgagggccggcacgtctgggac
gccgacggcacccgctacctcgacttcttcggcggcatcctcaccacgatgaccgcgcac
gccctgcccgaggtcaccaaggcgatcagcgagcaggccggccgtctcctgcactcctcc
acgctgtacctctcccgccccatggtggagttggcggagcggatcgccgcgctctccggc
atccccgacgcccgggtcttcttcaccacctccggcaccgaggccaacgacgccgcactg
ctcctggccaccacccaccgccggtccaaccagatcctggcgatgcgcaacagctaccac
ggccgttccttctccaccgtcggcatcaccggcaaccagagctggtcacccaccagcctc
tcgccgctgcagaccctctacgtccacggcggggtccgctcccgcggcccctacgccgac
ctcgacgacgccgcgtacaccgcggcctgcgtcgccgacctggaggacgtgctccagcag
gccgcgggcggcgtcgccgcgctgatcgccgaaccggtgcagggcgtcggcggcttcacc
gcaccgccggacgggctgtacgcggcgttccgcgaagtcctggcccgcgaggggatcctg
tggatcagcgacgaggtgcagaccggctggggccgcaccggcgagcacttctggggctgg
caggcgcacggcgagaacggcccgccggacctgctcaccttcgccaagggcatcggcaac
ggcatgtccatcggcggggtggtggcccgcgccgagatcatgaactgcctgcccgccaac
tccatctcgaccttcggcggcagcccgatcaccatggccgccggcctggccaacctcacc
tacctcctggagcacgacctccagggcaacgcccggcgggtcggcggactgctcatcgag
cgcctgcgggcggtgaccgccggcctcgacatggtgcgggaggtgcgcgggcggggcctg
atgatcggagtcgagctggtccggccgggcaccgacgagccgtccccggaggcagccacc
ggagtgctggaggccgcgcgggaacgcgggctgctggtcggcaagggcggccggggcggc
gcctcgctccgcatcgccccgccgctcacactcaccgtcgccgaggcggagcacggtgcc
gaactgctcgcggacgccctgcggtggacgcaggcgaacctcgcaccgcgctga

DBGET integrated database retrieval system