KEGG   Streptomyces albulus: DC74_7805Help
Entry
DC74_7805         CDS       T03082                                 

Definition
putative streptomycin-6-phosphate phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
salu  Streptomyces albulus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:salu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DC74_7805
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    DC74_7805
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DC74_7805
Enzymes [BR:salu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     DC74_7805
Exosome [BR:salu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DC74_7805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
8823298..8824656
Genome map
AA seq 452 aa AA seqDB search
MHRPSRRHVVTATALVAATAAAVAVTTAAGASDTKQQAQHAIKGGKAKNVILLIGDGMGD
SEITLARDYVAGANGRLNMDGFPLTGAYTTYAVHADGTPDYVTDSAASGSGWATGRKTVN
GRISKTPDTDKAIPTILELAQKNGYATGSVTTAELTDATPAVLASHATDRSCQGPGDMAK
CPTDTLAKGGPGSIAEQSVNHKVDVLLGGGKQRFDQKVTDGTYKGLTVTEQARKLGYQVV
TDNAGLKDVKAGKPVLGLFAPGNVPTEWTGKPAARGGTDPQRCVTSNANRPAATPTLADS
ATKAIELLEAKQKHAKQGFFLQIEGASIDKQDHAADPCGQIGETAAFDRAVKVARDYAAK
HPDTLVVTTADHGHTSQIVPLEATPPGLSSTLVTNEGQQLKVNYSTNTPGQSQEHTGTQV
RIAAQGPQAYRVLGVTNQTDLFTTIRSALGLK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcacagaccctcccgccggcacgtcgtgaccgccaccgccctggttgccgccaccgcg
gccgccgtggccgtgaccaccgcggccggcgcctccgacaccaagcagcaggcccagcac
gccatcaagggcggcaaggcgaagaacgtcatcctgctgatcggtgacggcatgggggac
tccgagatcaccctggcccgcgactacgtggccggcgccaacggccgcctgaacatggac
gggttcccgctcaccggtgcctacaccacgtacgcggtccacgccgacggcaccccggac
tacgtgaccgactccgctgcgagcggctccggttgggcgacgggccgcaagaccgtcaac
ggtcggatctccaagaccccggacaccgacaaggccatccccaccatcctcgaactggca
cagaagaacggctacgccaccggcagcgtcaccaccgccgaactcaccgacgccaccccg
gcggtgctcgcctcgcacgccaccgaccgctcctgccaggggccgggcgacatggccaag
tgccccaccgacaccctcgccaagggtggcccgggctcgatcgccgagcagtccgtcaac
cacaaggtcgacgtcctcctcggcggcggcaagcagcgcttcgaccagaaggtcaccgac
ggcacctacaagggcctgaccgtcaccgagcaggcccggaagctgggctaccaggtcgtc
accgacaacgccggcctcaaggacgtcaaggcgggcaagccggtcctcggcctgttcgcg
cccggcaacgtgccgaccgagtggaccggcaagccggcggcgcgcggcggcaccgacccg
cagcggtgcgtgaccagcaatgccaaccgcccggcggccaccccgaccctggcggactcg
gccaccaaggcgatcgagctcctggaggccaagcagaagcacgccaagcagggcttcttc
ctccagatcgagggcgcgtcgatcgacaagcaggaccacgccgccgacccctgcggccag
atcggcgagacggccgccttcgaccgtgccgtgaaggtggcccgcgactacgcggccaag
caccccgacacgctcgtggtcaccaccgccgaccacggccacaccagccagatcgtgccg
ctggaggccacccctcccggcctttcctcgaccctcgtcaccaacgagggccagcagctg
aaggtcaactactcgaccaacaccccgggtcagtcgcaggagcacaccggcacccaggtg
cggatcgccgcccagggcccgcaggcgtaccgggtcctcggcgtcacgaaccagacggac
ctgttcaccaccatccggtcggcgctcggcctgaagtga

DBGET integrated database retrieval system