KEGG   Snodgrassella alvi: SALWKB2_0198Help
Entry
SALWKB2_0198      CDS       T03063                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
salv  Snodgrassella alvi
Pathway
salv00620  Pyruvate metabolism
salv00680  Methane metabolism
salv01100  Metabolic pathways
salv01120  Microbial metabolism in diverse environments
salv01200  Carbon metabolism
Module
salv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:salv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SALWKB2_0198
  Energy metabolism
   00680 Methane metabolism
    SALWKB2_0198
Enzymes [BR:salv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SALWKB2_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHN27580
UniProt: X2H568
Position
complement(245920..248622)
Genome map
AA seq 900 aa AA seqDB search
MPTSLLDERKDAPLSADIKFLTEALFNVLQNETTATVQTVLRQLLSGNQPQTIIQQVVPT
LDLQQQQDLIRACSLFAQVLNIAEDAHHERRRQAYENDRQHPGRTSFTHVINQIQQQQIS
AAQLEQILQQTSISAVLTAHPTEVQRQCILCFQRHIRTILSEYDHSDHHYNEQLKQQAET
ILLALWQTDETRHFKISVSDEIYNSVNYFPLSFFKAVPALYRKLQQQLTSAYPQITLPDV
LSIGGWVGGDRDGNPYVNADTLQEAFIFQGDTLLKHYHQCLDELHQLLPLSSRRVQIDSS
VYHMAEQSPDTATAHSEEPYRRALTYIQARLNATSRQLNIAPHNQHHGLPPYKQPAELLQ
ELNNIASSLQQNGSALLTQGKLADLIRSVSLFGFHLMSIDLRQHAAKHAEVVAELFTHAG
LETFETLSEAAKQRVLLRELSTQRPLYSPYIQYSPHTMRELAIFQTAANIKNNYGESAIN
QCIISNAETVSDILVVALLLKETGLLSISNEKPTSRINIVPLFETIDALHNCISIMDKLF
NLPWYRAFLRSRDNLQEIMLGYSDSNKDGGYVTSQWSLYQAESRLVQLFGQHHIRLRLFH
GRGGSVGRGGGPSFDAIMAQPAGSVAGQIRITEQGEVITAKYADPTNAERNLEALIAATL
EATVLPMHNSEPDSELMNALSASAFTHYRQLITFPGFIDYFLQTSPIQEIASLNIGSRPA
SRKTLAKIQDLRAIPWVFSWTQNRLMLPAWYGFGSAVAELIEQDSTNLQRLQQQVKNSPF
FQTMLSNMDQVMAKADLTIAEAYVDLASDQQAARTIYTMLSEEFERSRQALLNILQRQHY
LSDNRTLARSLALRIPYLNALNWLQIHLLQQLRQQPDNSEILQLIHLTINGIAQGLRNTG
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgccaacatcacttctggacgagcgtaaagatgcgcccctgtcggcagatatcaaattc
ctgactgaagcactatttaacgtcctgcaaaatgaaaccacagctactgtacaaactgta
ttgcgccagctcctcagtggtaatcagccacaaaccatcattcaacaggtggtgcccact
ctggatttacaacaacagcaagatttgattcgcgcatgcagcctgtttgcacaagtactg
aatattgccgaagatgcccaccatgaacggcggcgacaggcatatgaaaatgacagacag
catcccggacgcaccagttttactcatgttatcaaccagattcagcaacagcagattagt
gctgcgcaactggaacagattttgcagcaaaccagtatcagtgcagtgctaaccgctcat
ccgactgaagtacagcgccagtgcattctgtgctttcagcgtcatatccgcaccattctc
agtgaatacgaccattctgatcatcactataacgaacagctaaagcaacaggctgaaact
attctgctggccttatggcagactgatgaaacgcgccatttcaaaatcagcgtaagtgat
gaaatttataatagcgttaactattttccattgagtttttttaaagcggtaccagctctt
taccgcaaactgcaacagcagctcaccagcgcgtatccgcaaataactcttcctgatgta
ctcagtatcggtggctgggttggcggagatcgtgacggtaatccgtatgttaatgcagat
actttacaggaagctttcatctttcagggtgacactttgttaaagcattatcatcaatgt
ctggatgagctgcaccagctgctgccgctttcttctcgtcgcgttcagattgacagcagc
gtgtatcatatggccgagcagtcaccagataccgcaacggctcatagcgaagaaccatac
cgccgtgctcttacctatatacaggcacgcctgaatgctacctcccggcaactgaatatt
gctccacacaaccagcatcatggtctgcctccatataaacaaccggcggaacttttgcag
gagcttaataatatagccagctctctacaacaaaatggcagtgccctgctcacacaaggc
aaactggcggacctgattcgttctgtttccctgttcggttttcatctgatgtccatcgac
ttgcgtcagcatgcagccaaacatgccgaagttgtagccgagctgtttacacacgccggt
cttgaaacatttgagacattaagtgaagcagccaaacagcgcgttctgttacgtgaatta
agcacccagcgcccgctatacagcccttatattcagtatagtccgcacaccatgcgtgag
ctggctatattccagactgcggcgaatattaaaaataactatggtgaaagcgctatcaat
cagtgcattatttctaacgccgaaaccgttagcgatatattggtggtagcgttattgctg
aaagaaaccggtttactcagcatcagtaatgagaaaccgaccagccggattaatattgtt
cctctgtttgagaccattgatgccttgcataattgcatcagtattatggataaattgttt
aatctgccctggtatcgtgcttttttgcgtagtcgtgataacctgcaggaaattatgctg
ggctactccgacagtaataaagacggtggttatgtaaccagccagtggtcactttatcag
gctgagtcgagactggtacaactgtttggtcagcaccatatccgtctgcgcctgtttcat
ggccgcggtggcagtgtcggtcgcggtggcggaccctcattcgacgcaatcatggcacag
ccggctggcagcgtagccggacaaatacgcattactgaacaaggagaagttattactgcc
aaatatgctgatccgaccaatgcagaacgtaatcttgaagcactcattgctgctactctt
gaagctactgttttacccatgcacaacagcgagcctgacagcgagctgatgaatgcattg
tctgccagcgcattcacacattaccggcaattaattaccttcccaggctttattgattat
tttctgcaaaccagcccgattcaggaaattgcgagcctgaatattggcagccgccccgcc
agccggaaaaccctggctaaaattcaggacttacgcgccataccatgggtattttcatgg
acccagaaccgcctgatgctgccggcctggtacggtttcggtagtgcagtagcggaactg
attgaacaggacagcaccaatctgcaacgcttacagcagcaggttaaaaacagtccgttt
tttcaaaccatgctttccaacatggatcaagtcatggccaaagccgatctcactattgct
gaggcttatgtagatcttgccagtgatcagcaagctgccagaaccatttacaccatgctt
tctgaagagtttgaacgcagccgacaggctttgcttaatattttgcaacgtcagcattat
ctgagtgataaccgcactctggcacgttctctggccttgcgtattccctatctgaatgca
cttaactggttgcagatacatctgctgcaacaattacgccagcagccggataatagtgag
atactccagctcatccatctgacaattaatggtattgcacaagggttgcgtaataccggc
tag

DBGET integrated database retrieval system