KEGG   Snodgrassella alvi: SALWKB2_0720Help
Entry
SALWKB2_0720      CDS       T03063                                 

Definition
Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC:2.6.1.19)
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
salv  Snodgrassella alvi
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SALWKB2_0720
   00650 Butanoate metabolism
    SALWKB2_0720
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SALWKB2_0720
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SALWKB2_0720
Enzymes [BR:salv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SALWKB2_0720
Amino acid related enzymes [BR:salv01007]
 Aminotransferase (transaminase)
  Class III
   SALWKB2_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(786045..787319)
Genome map
AA seq 424 aa AA seqDB search
MSQTSNVRQRQLAAAPRGVGFMCDFYIDHAKNAEFWSPEGKRYIDFAGGIGVLNTGHLHP
KVQKAVADQLQKFSHTCFNTVPYELYAKVAEKINARAPIAGDKRTMFVTSGAEAVENAIK
IARAYTKKRGVIAFNGAFHGRTNLTMALTGKIAPYKVDFGPFPADIVHAPYPNALHGVSI
EDALHGLHNIFKCHLAPSDVAAIIIEVVQGEGGFNVTPNEFLRALRQLADEHGIVLIFDE
IQSGFARSGKMFATELTGVQPDLMTIAKSLAGGFPLSGVVGKEAIMNAPVVGGLGGTYAG
SPLGLAAADAVIDVIEEEKLCERANILGNRLKERFNNLKEVIPSIAEVRGPGSMVAIELV
KPGTSEPDAERTKKVQQLALENGLMILTCGQYYNVIRCLYPLTIEDHVFDEALNILETAL
RQAQ
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaacaagcaatgttcgtcagcgtcaactggccgcagcccctcgtggcgtcggt
ttcatgtgcgatttttatattgatcacgctaaaaatgctgagttctggtctcctgaaggt
aaacgttatattgactttgccggaggcatcggcgttctgaatactggtcatctgcatccc
aaagtacaaaaagcagtagctgatcaactgcagaaattttcgcatacctgttttaatact
gttccatatgagctgtatgctaaggttgccgaaaaaattaatgccagagcacctatagcc
ggcgacaaacgcacaatgtttgttacctctggtgctgaagctgttgaaaatgccattaaa
attgcccgtgcctataccaaaaaacgtggtgtaattgcatttaacggtgcctttcatggt
cgtaccaatctcactatggctttaaccggcaaaatcgcaccctataaagtagatttcggg
ccgttccctgctgatatcgtacatgcaccttatccgaatgcactgcatggcgttagcatt
gaagatgcattgcacggtcttcataatattttcaaatgccatctagcgcccagcgatgtt
gctgctatcattatcgaagtagttcagggtgaaggcggctttaatgttacaccaaatgaa
tttctgcgtgccttacgccagctagctgatgaacacggaattgtgctgatttttgatgaa
attcagtccggcttcgcccgtagcggaaaaatgtttgctaccgaattgaccggcgtacag
ccagatttaatgactattgccaaatctctggctggcggttttccgctttccggtgtagtc
ggcaaagaagccataatgaatgctcctgtagtaggcggcctgggcggcacttacgccggt
agtccactgggactggctgctgctgatgcagttattgatgttatcgaagaagaaaaactg
tgcgagcgcgccaatattctgggtaacagattgaaagaacgctttaacaatttaaaagaa
gttattccgtctattgcagaagtacgcggaccgggctctatggtcgctattgaattagtt
aaacccggcacctcagaaccagatgctgaacgaaccaaaaaagtacagcaactggcgctg
gaaaacggtctgatgattctgacctgcggacagtattacaacgtaattcgttgtctctat
ccgcttactattgaagatcatgtatttgatgaagcattgaatatacttgaaactgccctg
cgtcaggctcaataa

DBGET integrated database retrieval system