KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW0123Help
Entry
MW0123            CDS       T00086                                 

Gene name
adhE
Definition
(GenBank) alcohol-acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00010  Glycolysis / Gluconeogenesis
sam00071  Fatty acid degradation
sam00350  Tyrosine metabolism
sam00620  Pyruvate metabolism
sam00625  Chloroalkane and chloroalkene degradation
sam00626  Naphthalene degradation
sam00650  Butanoate metabolism
sam01100  Metabolic pathways
sam01110  Biosynthesis of secondary metabolites
sam01120  Microbial metabolism in diverse environments
sam01130  Biosynthesis of antibiotics
sam01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MW0123 (adhE)
   00620 Pyruvate metabolism
    MW0123 (adhE)
   00650 Butanoate metabolism
    MW0123 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    MW0123 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MW0123 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MW0123 (adhE)
   00626 Naphthalene degradation
    MW0123 (adhE)
Enzymes [BR:sam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MW0123 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MW0123 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: BAB93988
NITE: MW0123
UniProt: A0A0H3JTX5
Position
142665..145274
Genome map
AA seq 869 aa AA seqDB search
MLTIPEKENRGSKEQEVAIMIDALADKGKKALEALSKKSQEEIDHIVHQMSLAAVDQHMV
LAKLAHEETGRGIYEDKAIKNLYASEYIWNSIKDNKTVGIIGEDKEKGLTYVAEPIGVIC
GVTPTTNPTSTTIFKAMIAIKTGNPIIFAFHPSAQESSKRAAEVVLEAAMKAGAPKDIIQ
WIEVPSIEATKQLMNHKGIALVLATGGSGMVKSAYSTGKPALGVGPGNVPSYIEKTAHIK
RAVNDIIGSKTFDNGMICASEQVVVIDKEIYKDVTNEFKAHQAYFVKKDELQRLENAIMN
EQKTGIKPDIVGKSAVEIAELAGIPVPENTKLIIAEISGVGSDYPLSREKLSPVLALVKA
QSTKQAFQICEDTLHFGGLGHTAVIHTEDETLQKDFGLRMKACRVLVNTPSAVGGIGDMY
NELIPSLTLGCGSYGRNSISHNVSATDLLNIKTIAKRRNNTQIFKVPAQIYFEENAIMSL
TTMDKIEKVMIVCDPGMVEFGYTKTVENVLRQRTEQPQIKIFSEVEPNPSTNTVYKGLEM
MVDFQPDTIIALGGGSAMDAAKAMWMFFEHPETSFFGAKQKFLDIGKRTYKIGMPENATF
ICIPTTSGTGSEVTPFAVITDSETNVKYPLADFALTPDVAIIDPQFVMSVPKSVTADTGM
DVLTHAMESYVSVMASDYTRGLSLQAIKLTFEYLKSSVEKGDKVSREKMHNASTLAGMAF
ANAFLGIAHSIAHKIGGEYGIPHGRANAILLPHIIRYNAKDPQKHALFPKYEFFRADTDY
ADIAKFLGLKGNTTEALVESLAKAVYELGQSVGIEMNLKSQGVSEEELNESIDRMAELAF
EDQCTTANPKEALISEIKDIIQTSYDYKQ
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgttaactatacctgaaaaagaaaatcgtggatcgaaagaacaagaagtggcaattatg
attgatgctctagctgacaaagggaaaaaagcattagaagcattatctaaaaagtcacaa
gaagaaattgatcatattgttcatcaaatgagcttagcagctgttgatcaacatatggtg
ctagcaaaattagcacatgaagaaactggaagaggtatatacgaagataaagcgattaaa
aatttatacgcttctgaatatatatggaattcaataaaagacaataagacagtagggatt
attggtgaagataaagaaaaaggattaacgtatgtagcggaaccaattggtgttatttgt
ggtgttacgccaacaacaaatcctacgtcgacaactatttttaaagcgatgattgcaatt
aagacaggaaatccaatcatttttgcattccatccaagtgcacaagaatcgtcgaagcgt
gcagcagaagttgtattagaagcggcaatgaaggcaggtgcacctaaagatattattcag
tggattgaagtgccttctatcgaagcaacaaaacaattaatgaatcacaaaggtattgca
ttagttctagcaacaggtggttcgggcatggttaagtctgcatattcaactggcaaaccg
gcattaggtgtgggaccaggtaacgtgccgtcttacattgaaaaaacagcacacattaaa
cgtgcagtaaatgatatcattggttcaaaaacatttgataatggtatgatttgtgcttct
gaacaagttgtagtcattgataaagaaatttataaagatgttactaatgaatttaaagca
catcaagcatactttgttaaaaaagatgaattacaacgcttagaaaatgcaattatgaat
gaacaaaaaacaggtattaagcctgatattgtcggtaaatctgcagttgaaatagctgaa
ttagcaggtatacctgtccccgaaaatacaaaacttatcatagccgaaattagcggtgta
ggttcagactatccgttatctcgtgaaaaattatctccagtattagccttagtaaaagcc
caatctacaaaacaagcatttcaaatttgtgaagacacactacattttggtggattagga
cacacagccgttatccatacagaagatgaaacattacaaaaagattttggactaagaatg
aaagcttgtcgtgtacttgtaaatacaccatcagcggttggaggtattggtgatatgtat
aacgaattgattccgtctttaacattaggttgtggttcgtacggtagaaactcaatttca
cataatgttagtgcgacagatttattaaacattaaaacgattgctaaacgacgtaataat
actcaaattttcaaggtgcctgctcaaatttattttgaagaaaatgcaatcatgagtcta
acaacaatggacaagattgaaaaagtgatgattgtctgtgaccctggtatggtagaattc
ggttatacaaaaacagttgagaatgtattaagacaaagaacggaacagcctcaaattaaa
atatttagcgaagtcgaaccgaacccatcaactaatacagtatataaaggtctggaaatg
atggttgatttccaaccggatacaatcattgcacttggtggtggttcagcgatggatgct
gcaaaagcaatgtggatgttctttgaacaccctgagacatcattcttcggtgctaaacaa
aagttcctagacatcggtaaacgtacttataaaataggcatgcctgaaaatgcgacgttc
atttgtatccctacgacatcaggtacaggttcagaagtaacaccatttgcagttatcaca
gatagtgaaacaaatgtaaaatatccgttggctgattttgctttaacacctgacgttgca
attattgaccctcaatttgtgatgagtgtgccaaaaagcgttacagcagatacaggaatg
gatgtactaacgcatgcaatggaatcatatgtatctgtaatggcttcagactacacaaga
ggtttgagtctacaagcgattaaattgacgttcgaatatttaaaatcatctgttgaaaag
ggtgataaagtttcaagagagaaaatgcataacgcatcaactttggctggtatggcattt
gcaaatgcattcttaggcattgcacactcaattgcgcataaaattggtggcgaatatggt
attccgcatggtagagcgaatgcgatattactaccgcatattatccgttataatgccaaa
gacccgcaaaaacatgcgttattccctaaatatgagttcttcagagcagatacagattat
gcagatattgccaaattcttaggattaaaaggtaatacgacagaagcacttgtagaatca
ttagctaaagctgtctacgaattaggtcaatcagtcggaattgaaatgaatttgaaatca
caaggtgtgtctgaagaagaattaaatgagtcaattgatagaatggcagagctcgcattt
gaagatcaatgtacaactgctaatcctaaagaagcactaatcagtgaaatcaaagatatc
attcaaacatcatatgattataagcaataa

DBGET integrated database retrieval system