KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW0242Help
Entry
MW0242            CDS       T00086                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sam00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
288601..290037
Genome map
AA seq 478 aa AA seqDB search
MTKLPRNFMWGGALAANQFEGGYDKGGKGLSVIDVMTSGAHGKARQITKSIDQNHYYPNH
EGIDFYHRYKEDIALFNEMGLKCLRTSIAWTRIFPNGDEDVPNEEGLAFYDRIFDELIAQ
DIEPVVTLSHFEMPLHLAKHYGGFRNREVVDYFVHFARVVFERYKDKVTYWMTFNEINNQ
MDTSNPIFLWTNSGVALTENDNPEEVLYQVAHHELLASALAVRLGKEINPKFKIGTMISH
VPIYPYSCHPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKKMLARKGYDVGWQEGDDSIL
QQGTVDYIGFSYYMSTAVKHDVDTTVENNIVNGGLNHSVENPHIATSDWGWAIDPDGLRY
TLNVLYDRYQLPLFIVENGFGAVDEVVDGHIHDDYRIEYLKAHITAAIEAVDQDGVDLIG
YTPWGIIDIVSFTTGEMKKRYGLIYVDRDNDGHGTMERLKKDSFYWYQQVIASNGDKL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattaccgcgaaattttatgtggggtggcgctcttgccgcaaatcaatttgaa
ggtggatatgataaagggggtaaagggttaagtgtaattgatgttatgacgagtggtgca
catggcaaagcacgtcagattacaaagtctatagatcaaaatcactattatccaaatcat
gaaggtattgatttttatcatcgttataaggaagatattgccttgtttaatgaaatggga
ttgaaatgtttacgtacgtcgattgcgtggacacgtatctttccgaatggggatgaagat
gtgccaaacgaagaaggactcgccttttatgatcgtatctttgatgaattaattgcacaa
gatattgaacctgttgtgacgttatcacattttgagatgccacttcatttagcgaaacat
tatggtggatttagaaatagagaagttgtcgattattttgtgcattttgcgcgtgttgta
tttgaaagatataaagataaagtgacatattggatgacgtttaatgaaattaataatcag
atggacacatcaaatcctatctttttatggacgaattctggggtagcattgacagaaaat
gataatcctgaagaagtcttgtatcaagtagcacatcatgaacttttagccagtgcttta
gcagttcgtcttggtaaagagattaatccgaagtttaagattggaacaatgatttcacat
gtacccatttatccatattcgtgtcatccgaaagatatgatggaagcacaaattgcgaat
cgcttacgtttctttttcccggatgtccaagtgagaggttattatccaagctatgctaaa
aaaatgttggcacgaaaaggatatgatgttggatggcaagaaggggacgacagtatttta
cagcagggcacggttgattatattggctttagttattacatgtctacggctgtaaaacat
gatgttgatactacagttgaaaacaacatcgtcaacggtggtttgaatcattctgtggag
aatccgcatatcgcaacgagtgattggggttgggcgattgatccagatggcttaagatat
acattgaatgtgttatatgatcgttatcagttaccactttttattgtggaaaatggtttt
ggtgcagttgatgaagtggtagatggacatattcatgatgattatcgcattgaatattta
aaagcacatattacagcagcgatagaagcagttgatcaagatggtgtagatttaatcggt
tatacaccgtggggaatcattgatattgtttcatttacaaccggtgaaatgaagaaacgc
tatggtttaatatatgttgatcgagataatgatggtcatggcacgatggaacgcttgaaa
aaagattcgttctattggtatcaacaagtgatagcatcaaatggagataaattataa

DBGET integrated database retrieval system