KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW0469Help
Entry
MW0469            CDS       T00086                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sam00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
530596..531399
Genome map
AA seq 267 aa AA seqDB search
MTKTKIMGILNVTPDSFSDGGKFNNVESAINRVKAMIDEGADIIDVGGVSTRPGHEMVSL
EEEMNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQWAGLYDHRMFQIVAK
YDAEIILMHNGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEA
EVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVRAVRV
HNVELNAKLAKGIDFLKENENARHNLS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacaaaaattatgggcatattaaacgtcacacctgattcattctcagatggt
ggaaaatttaataatgttgaatcagctataaatagagtgaaagccatgatagatgaaggt
gctgacattatagatgttggaggtgtttcaacgagaccaggtcatgaaatggtttcatta
gaagaagagatgaacagagtattacctgttgttgaagctattgtcggttttgatgtaaaa
atttcagtcgatacatttcgaagtgaggttgctgaagcatgtttaaaattaggcgttgat
atgattaatgatcaatgggcgggtctgtatgatcatcgtatgttccaaattgtagctaaa
tatgacgcggaaattattttaatgcataatggaaatggtaatcgtgatgaaccggttgtc
gaagaaatgttaacatctttgttagcacaagcacatcaagctaaaatagctggtatacct
tcaaataaaatttggctagatccaggtataggtttcgctaaaactagaaatgaagaagcc
gaagttatggcaagactggatgaacttgttgcaacagaatatccagttttattagcgaca
agccggaaacgtttcactaaagagatgatgggttatgatacaacaccggttgaaagagat
gaagtaactgcagctacgactgcatatggtattatgaaaggcgttagagcagtacgcgtt
cataatgtcgagttgaatgctaaattagctaaaggtatagattttttaaaggagaatgaa
aatgcaagacacaatctttcttaa

DBGET integrated database retrieval system