KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW0741Help
Entry
MW0741            CDS       T00086                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
835290..836030
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
KTEGAIYEGFLEYARNFKKYEGKNQETIDNEMDHFKPTETLKELSEALDTIKDQVDEVFD
PILVIQAENDNMIDPQSANYIYDHVDSDDKDIKWYSQSGHVITIDKEKEQVFEDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcagataaaattaccaaaacctttcttttttgaagaaggcaaacgtgccgtgttatta
ttacatggatttacaggcaattcgtctgatgtacgtcaattaggtcgatttttacaaaaa
aagggatatacttcgtatgcaccacaatatgaaggtcacgcggcaccaccagaggaaata
ctgaaatctagtcctttcgtttggtttaaagatgcgttagatggttatgattatcttgtt
gaacaaggttatgatgaaattgttgttgctggtctatcattaggtggggattttgcttta
aaattaagcttaaatagagatgtaaagggtattgtaacgatgtgtgcaccaatgggtggc
aaaactgaaggtgccatttatgaaggctttttagagtatgcacgtaattttaaaaagtat
gaaggtaaaaatcaagagactattgataatgaaatggatcattttaaaccaactgaaact
ttaaaagaactaagtgaagcattagatacgattaaagatcaagttgatgaggtatttgac
ccaattttagtgattcaagcagaaaacgacaatatgattgatccacaatccgcaaattat
atatatgaccatgtagattctgatgacaaagacatcaagtggtatagtcaatcaggacat
gttattacgattgataaagaaaaagaacaagtatttgaagatatttatcaatttttagag
tcattagactggtcagaataa

DBGET integrated database retrieval system