KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1216Help
Entry
MW1216            CDS       T00086                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MW1216 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MW1216 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MW1216 (thrC)
Enzymes [BR:sam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MW1216 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1328883..1329944
Genome map
AA seq 353 aa AA seqDB search
MRRWQGLVEEFKAHLPVNENTPKLTLNEGNTPLIHCENMSKILGIDLYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKIVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAKSGEIELVNSVNPFRIEGQKTGSFEIVQQLDGEAP
DILAIPVGNAGNITAYWKGFKEYHEAKGSQLPKMFGFQAEGASPIVQNKVIKNPETIATA
IRIGNPASWDKATNALKESNGLIDSVTDDEILEAYQLMTTKEGVFSEPASNASIAGLIKL
HRQGKLPQGKKVVAILTGNGLKDPDTAISLLDNPIKPLPNDKDSIIDYIKGAL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatggcaaggattagtagaagagtttaaagcacatttaccagtaaatgaaaat
acaccaaaattaacattgaacgagggaaatacaccactcattcattgtgaaaatatgtct
aaaatactaggtatagatttatatgtgaagtatgaaggtgccaatccgacaggttcattt
aaagatcgcggtatggtaatggctgtgacaaaagcaaaagagcaaggtaagaaaattgta
atatgcgcttcgactggaaatacatcagcgtctgcagcagcatatgcagcgagagcaggt
ttaaaagctatcgtcgtaataccagaaggtaaaattgcattaggtaaattgtcgcaagca
gtaatgtatggtgcagaaatcgtttctattgaaggaaactttgatgaagctttagaaatt
gtaaaagaaattgcaaaaagtggcgaaatagagcttgtaaactctgtcaatccatttaga
atcgaagggcaaaagacaggctcatttgaaattgtacaacaattagacggtgaagcacct
gatattttagcgattcctgtaggtaatgcaggtaatattactgcatattggaaaggcttt
aaagaatatcatgaagctaaaggttcacaattgccgaaaatgtttggcttccaagctgaa
ggcgcatcaccaattgttcaaaataaagtcattaaaaatcctgaaacgattgcaactgct
attcgaattggtaatcctgctagttgggataaggcgactaatgctcttaaagaatcaaat
ggattaatagatagtgttactgatgatgaaattctagaagcatatcagttaatgacaact
aaagaaggtgtctttagtgaaccagcgagtaatgcttctattgcaggtttaattaaattg
catagacaaggtaaattacctcaaggtaaaaaagtagttgctattttaactggtaatgga
ttaaaagatcctgatactgctatttcactactagataatccgataaagccattgccaaat
gataaagatagcattatcgattatattaaaggagctttataa

DBGET integrated database retrieval system