KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1592Help
Entry
MW1592            CDS       T00086                                 

Gene name
ruvA
Definition
(GenBank) holliday junction DNA helicase
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sam00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MW1592 (ruvA)
Enzymes [BR:sam01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MW1592 (ruvA)
DNA repair and recombination proteins [BR:sam03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MW1592 (ruvA)
    RecFOR pathway proteins
     MW1592 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(1722804..1723406)
Genome map
AA seq 200 aa AA seqDB search
MYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKHLDHEVLIRTSLIVREDAQLLY
GFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGKKTA
RQIVLDLKGKVKITEEDSDSLLQVDATSTVQDQFVQEAMLALEALGYSKRELAKVEKTLN
KNKYDSVDEAVKAGLQLVVS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgtatgtcaaaggtaagttaacacatttatatcctacacacgtagttgttgaa
actgctggtgttggttatgaaattcaaacaccaaattcttatcgttttcaaaagcatcta
gatcatgaagttttaattcgtacatctttaattgttcgtgaagatgcacaattattgtat
ggatttagtagtgaagaagagaaagatatgttcttgagtttaattaaagttactggtatt
ggtccgaaatcagctttagctattttagcgacaagtacgcctaatgaagtaaaacgtgcc
attgaaaatgaaaatgatacgtatttaactaaattcccaggaattggtaagaaaacggca
agacagattgtcttagatttaaaaggtaaagtgaaaatcactgaagaagatagcgattca
ttattacaagtagacgctacttcgacggtgcaagatcaattcgtgcaagaagcaatgtta
gcgttagaagcattaggttattctaaacgagagcttgcaaaagttgagaaaacgttaaat
aaaaataaatatgactcagttgatgaagctgttaaggcaggtcttcaattagttgtatct
taa

DBGET integrated database retrieval system