KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1676Help
Entry
MW1676            CDS       T00086                                 

Gene name
acsA
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00010  Glycolysis / Gluconeogenesis
sam00620  Pyruvate metabolism
sam00640  Propanoate metabolism
sam00680  Methane metabolism
sam01100  Metabolic pathways
sam01110  Biosynthesis of secondary metabolites
sam01120  Microbial metabolism in diverse environments
sam01130  Biosynthesis of antibiotics
sam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MW1676 (acsA)
   00620 Pyruvate metabolism
    MW1676 (acsA)
   00640 Propanoate metabolism
    MW1676 (acsA)
  Energy metabolism
   00680 Methane metabolism
    MW1676 (acsA)
Enzymes [BR:sam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MW1676 (acsA)
Lipid biosynthesis proteins [BR:sam01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MW1676 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAB95541
NITE: MW1676
UniProt: A0A0H3K3J2
Position
complement(1818050..1819756)
Genome map
AA seq 568 aa AA seqDB search
MKVEVYKGAQGKHNLKDYEEIYNTFDWKDVEQAFSWSETGKMNMAYECIDRHVDQGLGDK
IALNYKDEYRKESYTYKDMQRLSNKAANVLSEHAEVDKGDRVFIFMSRTPELYFALLGVL
KIGAIVGPLFEAFMEKAVADRLENSEAKVLITNKALLPRVPVDKLPNLKKIVVVDEDVED
NYIDFISLMETASDEFDIEWLKSDDGLILHYTSGSTGQPKGVLHVQQAMLVHYISGKYVL
DLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNCIAGGRFSPEQWYSMIEDFKVTIWYT
APTALRMLMSAGDDIVEKYDLSSLRSILSVGEPLNPEVIKWAKKVYGLTVLDTWWMTETG
GHMIVNYPTMDVKLGSMGKPLPGIQAAIIDDAGNELPPNRMGNLAIKKGWPSMMYRIWKN
PEKYKSYFIGDWYVSGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
EAGIIGKPDPVRGEIIKAFVALRKGYEPTDELKEEIRLFVKEGLSAHAAPREIEFKDKLP
KTRSGKIMRRVLKAWELNLDAGDLSTME
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgaagtttataaaggagcgcaaggtaaacataaccttaaagattatgaagaa
atatataatacttttgattggaaagacgtagaacaagcattttcttggagtgaaactgga
aaaatgaacatggcatatgaatgtatagatcgccatgtagatcaaggattaggggataaa
atagcgttaaattacaaagatgagtacagaaaagaatcgtatacttataaagatatgcaa
cggttatctaataaagcagcgaatgttttgtctgaacatgcagaagttgacaaaggtgac
agagtatttatatttatgtcgcgtacacctgaactatattttgcgttgttaggtgtttta
aaaattggtgcaattgttgggccgttatttgaagcatttatggaaaaggcagttgcggat
agattagagaacagtgaagctaaagtgttaattactaataaggcattgttacctcgagta
cctgtagataaattaccgaacttgaaaaaaattgttgtcgtagatgaggatgtagaagac
aattacatagacttcattagtttgatggaaactgctagcgatgaatttgacattgaatgg
ttaaagtcggatgatggtttgattttacattatacatcaggttctactgggcaacctaaa
ggtgtattgcatgttcaacaagcaatgttagtgcactatatttctggaaaatatgtatta
gatttacaagaagatgatgtttattggtgtacagcagatccaggttgggttacaggaaca
tcttatggtatttttgcaccatggttaaatggcgctacaaattgtatagctggtggtcgc
ttttcaccagaacagtggtatagtatgattgaagattttaaagtgacgatttggtatacg
gcaccaacagctttaagaatgttaatgagtgctggtgacgatattgttgagaaatatgac
ttgtcatcgttacgttcgattctatcagtaggtgagcctttaaatcctgaagttataaaa
tgggcgaaaaaagtatacggtttaacggtgttagatacttggtggatgacagaaacaggt
ggacatatgattgttaactatccaacgatggacgtcaagcttggctcaatgggcaaacca
ttacctggtattcaagctgcaattatcgatgatgcaggtaatgaattaccaccaaatcga
atgggcaaccttgctataaaaaaaggctggccatcaatgatgtatcgtatctggaagaat
ccagaaaaatataagtcatattttattggagactggtatgtatctggtgattcggcatat
aaagatgaagatggttacttctggttccaaggacgtgttgatgatgtaattatgacagct
ggtgaacgagttggaccatttgaggttgagtctaaattggttgaacacgaagcagttgcc
gaagcaggaattattggtaaacctgatccggttcgcggtgaaataattaaggcgtttgtt
gcactgagaaaaggatatgaaccaacagacgaattaaaagaagaaattcgtttatttgtt
aaagaaggtttgtcggcacatgcagcaccacgtgaaatcgaatttaaagataaattacct
aaaacacgctcaggtaaaattatgagacgtgtattaaaagcttgggaattaaatttagat
gcaggggatttaagtacaatggaataa

DBGET integrated database retrieval system