KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW2419Help
Entry
MW2419            CDS       T00086                                 

Gene name
gtaB
Definition
(GenBank) UTP-glucose-1-phosphate uridyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00040  Pentose and glucuronate interconversions
sam00052  Galactose metabolism
sam00500  Starch and sucrose metabolism
sam00520  Amino sugar and nucleotide sugar metabolism
sam01100  Metabolic pathways
sam01130  Biosynthesis of antibiotics
Module
sam_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MW2419 (gtaB)
   00052 Galactose metabolism
    MW2419 (gtaB)
   00500 Starch and sucrose metabolism
    MW2419 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    MW2419 (gtaB)
Enzymes [BR:sam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MW2419 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: BAB96284
NITE: MW2419
UniProt: Q8NUU9
Position
complement(2576097..2576963)
Genome map
AA seq 288 aa AA seqDB search
MKKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRH
KRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQF
IGNEPFAVLLGDDIVESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNG
RQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNND
NQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKELGL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaataaaaaaggcaatcattcccgctgctggtttagggactagatttttacca
gcaactaaagcgatgccaaaggaaatgcttcctatcttagataaacccacaatacaatat
atcgttgaagaagctgcaagagctggaattgaagatattattatagtgacaggtcgccac
aaacgcgcgattgaagatcattttgatagtcaaaaagaattagaaatggtgttaaaagaa
aaaggtaaatctgagttactagaaaaagttcagtattcaacagaacttgcgaatattttt
tatgtaaggcagaaagaacaaaaaggtttagggcatgcgattagttctgcgcgtcaattt
atcggcaatgaaccatttgcggtattattaggtgacgatattgttgaatctgaagtgcca
gcagtgaaacagttgattgacgtttatgaagaaacagggcactcagttataggtgtccaa
gaagttccggaagcagatactcatcgttatgggattattgacccattaactaaaaacgga
cgtcagtatgaagtgaaaaagtttgttgaaaagccagcacaaggtacggcaccatcaaac
ctagctattatgggacgttatgtattaacgcctgaaattttcgattatttaaaaacgcaa
aaagaaggcgcaggtaacgaaattcagttaacagatgcgattgaacgtatgaataatgat
aaccaagtgtatgcatatgacttcgaaggcgaacgttatgacgttggagaaaaattaggc
ttcgttaaaacaacgatagaatatgcattgaaagatgacagtatgcgagaagaattaaca
cgatttattaaagaattagggttataa

DBGET integrated database retrieval system