KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW2435Help
Entry
MW2435            CDS       T00086                                 

Gene name
fbp
Definition
(GenBank) fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00010  Glycolysis / Gluconeogenesis
sam00030  Pentose phosphate pathway
sam00051  Fructose and mannose metabolism
sam00680  Methane metabolism
sam01100  Metabolic pathways
sam01110  Biosynthesis of secondary metabolites
sam01120  Microbial metabolism in diverse environments
sam01130  Biosynthesis of antibiotics
sam01200  Carbon metabolism
Module
sam_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MW2435 (fbp)
   00030 Pentose phosphate pathway
    MW2435 (fbp)
   00051 Fructose and mannose metabolism
    MW2435 (fbp)
  Energy metabolism
   00680 Methane metabolism
    MW2435 (fbp)
Enzymes [BR:sam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MW2435 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 GP24_25
Motif
Other DBs
NCBI-ProteinID: BAB96300
NITE: MW2435
UniProt: Q8NUT7
Position
2597990..2599954
Genome map
AA seq 654 aa AA seqDB search
MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEYEAFQH
VLRNGSGNVRAKINDIFKERLSTKELNDLTALVYYPEDKLKLIKSDFQSCGQLNVWYITT
IEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVNQVIELK
QADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYHSLDIQWGNHDVLWVG
AYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAFKPKKRPDKH
ERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDTNEITVYGNT
YPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRKGSLYLPYNGN
LLIHGCIPVDENGEMESFEIDGHTYSGQELLDVFEYHVRKSFDEKENTDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVRKMLSDFGLNADEGRI
INGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQQFN
AKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKDLQAQIDILKMLMHDRYLD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaattactgaaaaagaattaaaaaagaagtatttagatttactatcccaaaat
tttgatactccagaaaaacttgcaactgaaattatcaatttagaatcaattttagaatta
cctaaaggtacggaacatttcgtcagcgatttacatggtgaatacgaagctttccaacac
gtattacgcaacggttctgggaatgtgcgagcgaaaatcaatgatattttcaaagagaga
ctttcaactaaggagcttaatgatttaactgctcttgtctactatccagaagacaaatta
aaattgattaaaagtgatttccaaagttgcggtcaacttaatgtctggtatatcacaaca
atcgaacatttaattgagttgattaaatattgttcttcaaaatatacgcgttcaaaactg
cgtaaagcattgccaaaacaatacgtttatattattgaggaactactgtataaaagtaat
gaatatcaaaataaaaaatcatattacgaaacacttgttaaccaagtaattgaacttaaa
caggcagatgatttaattattggactcgcttattccgtacaacgcttagtcgtcgatcat
ttacacgttgtcggtgatatttatgatcgtggaccacaaccagataaaattatggataca
ctgattaattatcattccctagatattcaatggggtaatcatgatgtgctttgggttgga
gcctatgctgggtcaaaagtatgcttagcaaacttacttcgaatttgtgcacgctatgat
aatttagatattatcgaagacgcttatggcattaatttaagaccactgcttactttagct
gaaaaatactatgacgcagataatcctgcttttaagcctaaaaaaagacctgacaaacac
gaacgtttaactcaacgtgaagaaagtcaaattactaaaattcatcaagctattgcgatg
attcaattcaagttagaaataccaattattaaacgtcgtccaaatttcgaaatggaagaa
cgtcttgtgcttgaaaaggttaattatgatacaaatgaaattacagtttatggtaataca
tacccattgaaagacacatgtttccaaactgtcaatcgtgataatccagcagaattacta
cctgaagaagaagaagtcatgaataaactattattgtcattccaacaatctgaaaaatta
cgtcgtcatatgtctttcttgatgcgtaaaggctctctttacttaccatataatggcaat
ttactcattcatggttgtattccagttgatgaaaatggtgagatggaatcatttgaaatt
gatggtcatacttacagcggccaagaattattagatgtatttgagtatcatgtccgtaaa
tcatttgatgaaaaagaaaatactgatgacttatcgacggatttagtttggtatttatgg
actgggaaatattcgtcattatttggaaaacgtgccatgactacgtttgaacgatacttt
attgcagataaagcttctcataaagaagaaaaaaatccatactatcatctacgtgaagat
gtgaatatggttcgtaaaatgctcagtgattttggattaaatgcagatgaaggtcgcatt
attaatggtcacacaccagtgaaagaaatcaatggcgaagatcctatcaaggctgatgga
aagatgcttgtcattgatggtggcttttcaaaagcttatcagtcaacaactggcattgca
ggctatacactattgtataattcattcggtatgcaactcgttgcacaccaacaatttaac
gctaaagaaaaaatactttccgaaggtatcgatgaactttctataaagcgcgtcgtagat
aaagaattacaacgtaagaagattcgtgataccaatattggtaaagatcttcaagctcaa
atagatattttgaaaatgttaatgcatgatcgctacttagactaa

DBGET integrated database retrieval system