KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0053Help
Entry
gbs0053           CDS       T00104                                 

Definition
(GenBank) Unknown
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
san00010  Glycolysis / Gluconeogenesis
san00350  Tyrosine metabolism
san00620  Pyruvate metabolism
san00625  Chloroalkane and chloroalkene degradation
san00626  Naphthalene degradation
san00650  Butanoate metabolism
san01100  Metabolic pathways
san01110  Biosynthesis of secondary metabolites
san01120  Microbial metabolism in diverse environments
san01130  Biosynthesis of antibiotics
san01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gbs0053
   00620 Pyruvate metabolism
    gbs0053
   00650 Butanoate metabolism
    gbs0053
  Lipid metabolism
   00071 Fatty acid degradation
    gbs0053
  Amino acid metabolism
   00350 Tyrosine metabolism
    gbs0053
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    gbs0053
   00626 Naphthalene degradation
    gbs0053
Enzymes [BR:san01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     gbs0053
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     gbs0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CAD45698
UniProt: Q8E7U2
Position
69465..72107
Genome map
AA seq 880 aa AA seqDB search
MTEKTKAVETTDVALAIDTLVQNGLKALDEMRQLNQEQVDYIVAKASVAALDAHGELALH
AVEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVCGITP
TTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQWIEQ
PSIDATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQAAH
DIVMSKSFDNGMVCASEQAVIIDKEIYKEFVEEFKSYHTYFVNKKEKALLEEFCFGAKAN
SKNCAGAKLNPNIVGKSAVWIAEQAGFTVPEGTNILAAECTEVSEKEPLTREKLSPVIAV
LKAESTEDGVEKARQMVEFNGLGHSAAIHTKDADLAREFGTRIRAIRVIWNSPSTFGGIG
DVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWFKVPSKTYFERDSI
QYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFAEVEPDPDITTVMKG
TDLMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPELGK
KTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVMTVPGFIAA
DTGMDVLTHATEAYVSQMANDYTDGLALQAIKIVFDYLERSVKDADFEAREKMHNASTMA
GMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRA
DEKYQDIAKLLGLPAATPEEAVESYAKAVYDLGTRLGIKMNFRDQGIDEKEWKEKSRELA
FLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYEERPGRRK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaactaaagcggtagaaactacagatgttgctcttgcaattgatacattg
gttcaaaacggtttaaaagcacttgatgagatgcgtcaacttaatcaagaacaagttgat
tatattgtagctaaagcttctgttgcagccttggatgcccatggagaacttgctcttcat
gcagtagaagaaactggtcgtggtgtctttgaagataaagcgacaaaaaatttatttgca
tgtgaacacgtcgttaacaacatgcgtcatacaaagacagtgggagttattgaagaagac
gatgtcacaggcttgacattaattgctgaaccagtgggagttgtctgtggtattacgcca
acaaccaacccgacttcaactgctattttcaagtcattaatctctcttaaaacacgtaat
ccaattatttttgccttccacccatcagcacaagaatcatcagcacatgcagcacgtatt
gttcgtgatgctgctattgctgctggagctcctgaaaattgtgtccaatggattgaacaa
ccatcgattgatgcaactaatgctttgatgaaccatgatggtattgccactatccttgcg
acaggtggtaatgcgatggttaaagctgcctactcatgtgggaaacctgcccttggtgta
ggtgctgggaatgttccagcttatgttgaaaaatcagctaatatccgacaagccgctcac
gatattgttatgtctaaatcatttgataacggtatggtatgtgcatcagaacaggctgtt
attattgataaagaaatttataaagaatttgttgaagaatttaaatcttatcatacttat
ttcgttaataagaaagaaaaagctcttcttgaagaattctgttttggtgcaaaagcaaat
agcaaaaactgtgctggtgcaaaattaaatccaaatattgttggaaaatcagcagtttgg
attgctgaacaagctggatttactgttccagaaggaacaaatattcttgccgcagaatgt
actgaagttagtgaaaaagaacctttgacacgtgaaaaactatcacctgttattgccgta
ttgaaagctgaatctacagaagatggtgttgaaaaagctcgtcaaatggttgagtttaat
ggtctaggacactcagctgctattcatacaaaagatgcagacttagctcgtgaatttgga
actagaattcgtgctatccgtgttatttggaattctccttctacttttggtggtattggg
gatgtttacaatgctttcttgccatcattgactcttggttgtggttcgtatggacgtaac
tcagttggtgataacgttagtgctataaatctcttgaatatcaaaaaagtaggaagacgt
agaaataatatgcaatggtttaaagtcccttcaaaaacatacttcgaacgtgattctatt
caatatttgcaaaaatgtcgcgatgttgaacgtgtcatgattgttacagatcacgccatg
gttgagcttggtttcttggatcgtatcattgaacaacttgatcttcgtcgcaataaagtt
gtttatcagatttttgctgaagtagaaccagatccagacattacaacagtaatgaaagga
acagatttgatgcgtaccttcaaaccagacactattattgcattaggtggtggttctcct
atggatgctgcgaaagttatgtggctcttctatgaacaaccagaagttgatttccatgac
ctcgttcaaaaattcatggatatccgtaaacgtgcgttcaaattcccagaacttggtaag
aaaacaaaatttgttgctattccaacaacttctggaacaggttctgaagtgacaccattt
gccgttatctctgacaaagcaaataatcgtaaatatccaatcgctgattattcattaaca
ccaactgtagctatcgttgatccggcccttgttatgactgttcctggttttattgcggct
gatacgggtatggatgtattgacacatgcaacagaggcttatgtttcacagatggcaaat
gattatacagacggacttgcccttcaagcaattaaaattgtgtttgactacttagaacgc
tcagtaaaagatgctgattttgaagcacgtgaaaagatgcacaatgcgtcaactatggca
ggtatggctttcgccaatgcattcttaggtatttctcactcaatggcgcataaaattggc
gcacaattccataccgtacacggacgtacaaatgcaattcttttgccgtatgttatccgc
tataatggaactcgtccagctaaaacagcaacatggcctaagtacaattactatcgtgct
gatgaaaaatatcaagatatcgctaaattactcggcttaccagcagcaacaccagaagaa
gctgtcgaatcatatgcaaaagctgtgtatgaccttggaacacgtttaggtattaagatg
aatttccgcgaccaaggcattgatgaaaaagaatggaaagaaaaatctcgtgaactagct
ttcttagcatatgaagatcaatgttcaccagcaaatccacgccttccgatggtagatcac
atgcaagaaatcatcgaagatgcttattatggttatgaggaacgtccaggacgtcgtaag
taa

DBGET integrated database retrieval system