KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0117Help
Entry
gbs0117           CDS       T00104                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    gbs0117
Enzymes [BR:san01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     gbs0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(128398..129309)
Genome map
AA seq 303 aa AA seqDB search
MSNIVIIGSISMDLVMETNRIAKEGETVFGQRFSMVPGGKGANQAVAIGRLSQDRDNITI
LGAIGEDSFGPILLDNLNKNHVTTDFVGTIPSSSGVAQITLYNNDNRIIYCPGANGKVDT
KKWSQEWSIIKEADLVVLQNEIPHQANMKIANFCKEHSIKLLYNPAPSRKTDIEMLDKVD
YFTPNEHECQELFPNQKLEDILATYPEKLIVTLGTKGAIYSDGKESHLIPALETKAVDTT
GAGDTFNGAFGYAISKKFKIANALRFATLAAHLSVQKFGAQGGMPTIKEMEDNQHYEKDW
HIK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacattgtcattatcggtagtatttccatggacttagttatggaaaccaatcgt
atcgccaaagagggagaaaccgtatttggccaacgtttttcaatggttccaggaggtaaa
ggtgctaatcaggctgtcgctattgggcgtcttagccaagatcgagataatattactatt
cttggtgccattggcgaggattcttttggtcccattcttttggataatttaaacaaaaac
catgttactacggattttgtgggaacgataccatcttcttcaggtgttgcccaaatcact
ctttataataatgataatcgaatcatttactgtcctggagccaacggaaaagttgatact
aaaaagtggtctcaggagtggtcaataattaaagaagctgatttagttgtattacaaaat
gaaattcctcatcaagcaaatatgaaaattgctaatttttgtaaagaacatagtattaaa
ttactctataatcctgcaccatctagaaagactgatattgagatgctcgataaggtcgat
tatttcacaccaaatgaacacgaatgtcaagagctgttcccaaaccaaaaactagaggat
atattagccacatatcctgaaaaactaattgtaacactcggcacaaaaggagccatctac
tctgatggaaaagaaagccatttaattcctgccttagaaactaaagctgttgatacaact
ggtgcaggtgatacttttaacggtgcattcggttatgctatctcgaaaaaatttaagatt
gctaatgccttacgttttgcaactctagctgctcacttatccgtgcaaaaatttggtgca
cagggtggcatgcctacaattaaagaaatggaggacaaccaacattatgaaaaagactgg
catattaaatag

DBGET integrated database retrieval system