KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0263Help
Entry
gbs0263           CDS       T00104                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    gbs0263 (glpK)
Enzymes [BR:san01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     gbs0263 (glpK)
Exosome [BR:san04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   gbs0263 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
280080..281588
Genome map
AA seq 502 aa AA seqDB search
MSSEEKYIMAIDQGTTSSRAIIFNKKGEKIASSQKEFPQIFPQAGWVEHNANQIWNSVQS
VIAGAFIESSIKPGQIEAIGITNQRETTVVWDKKTGLPIYNAIVWQSRQTAPIADQLKQE
GHTNMIHEKTGLVIDAYFSATKVRWILDHVPGAQERAEKGELLFGTIDTWLVWKLTDGLV
HVTDYSNAARTMLYNIKELKWDDEILELLNIPKAMLPEVKSNSEVYGKTTPFHFYGGEVP
ISGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGEEMQLSQNNLLTTIGYGINGKV
HYALEGSIFIAGSAIQWLRDGLRMIETSSESEGLAQSSTSDDEVYVVPAFTGLGAPYWDS
NARGSVFGLTRGTSKEDFVKATLQSIAYQVRDVIDTMQVDSGIDIQQLRVDGGAAMNNLL
MQFQADILGIDIARAKNLETTALGAAFLAGLSVGYWESMDELKELNATGQLFQATMNESR
KEKLYKGWRKAVKATQVFAQED
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagaagaaaaatacattatggcgattgaccagggaacaacaagttctcgagca
attatttttaataaaaaaggtgaaaaaattgcgagtagccaaaaagaatttccccaaatt
tttcctcaagcaggctgggtagagcataatgctaatcagatttggaattctgttcaatct
gtcattgctggagcttttattgaatcaagcatcaaacctggacagatagaggctattggg
attaccaatcaacgtgaaacaactgttgtttgggataaaaaaacaggtcttccaatttat
aatgctattgtatggcaatcgcgacaaacagccccgattgctgatcaattgaagcaagaa
ggtcatactaatatgattcatgagaaaacaggtcttgtcattgatgcttacttctcggca
acaaaagttcgttggattttagaccatgttcctggagcacaggaacgtgctgaaaaagga
gagttgctttttggaacaattgatacttggttagtttggaagttaactgatggtctcgtc
catgttacagactattcaaatgctgctcgtacgatgctttataatattaaagaacttaaa
tgggatgatgaaattttagagttactgaatattcctaaagcaatgttaccagaagtaaaa
tctaattctgaagtttatgggaaaactactccattccatttttacggtggagaggtgcca
atttctggtatggctggtgaccaacaggcagcattatttggacagttggcctttgaacct
ggtatggtaaaaaacacttatggtacaggttccttcattatcatgaatacgggcgaagag
atgcaactgtctcaaaataatctattaacaacgattggttacggcattaatggtaaggtt
cattatgcacttgaaggatcaatcttcattgcaggaagcgctattcaatggttacgtgat
ggtcttagaatgattgaaacgtcaagtgagtcagaaggccttgctcaatcatcaacaagt
gacgatgaggtttatgtggttccagcttttacaggtttgggtgcaccgtattgggattca
aatgctagagggtcagtatttggattaactcgtgggacaagtaaagaagattttgttaaa
gctacacttcagtcaattgcttatcaagtacgagacgttattgacactatgcaagttgat
tcaggaattgatatccaacaacttcgtgtagatggtggagctgcaatgaataatttatta
atgcaattccaagcggatattttagggattgatattgctcgtgcgaagaaccttgaaact
actgccttgggtgcagctttcttagccggactttcagttggctattgggaaagtatggat
gaactaaaagaactaaacgcaacaggacaacttttccaagcaacaatgaatgagtctcga
aaagaaaaactgtataaagggtggagaaaagctgtcaaagcgacacaagtatttgctcaa
gaggattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system