KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0264Help
Entry
gbs0264           CDS       T00104                                 

Gene name
glpD
Definition
glycerol-3-phosphate dehydrogenase
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    gbs0264 (glpD)
Enzymes [BR:san01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     gbs0264 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
281601..283430
Genome map
AA seq 609 aa AA seqDB search
MEFSRETRRLALQRMQDRTLDLLIIGGGITGAGVALQAAASGLDTGLIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYDEPGSTFSMFRL
KVAMDLYDLLAGVTNTPAANKVLSAEDVLKREPDLQKEGLLGGGIYLDFRNNDARLVIEN
IKRANRDGAYIASHVKAEDFLFDDNNQIIGVRARDLLTDQVIDIKARLVINTTGPWSDTV
RNFSNEGKQIHQLRPTKGVHLVVDRQKLNVSQPVYVDTGLNDGRMIFVLPREDKTYFGTT
DTDYHGDLEHPTVTKEDVDYLLNIVNKRFPEAELTIDDIESSWAGLRPLLSGNSASDYNG
GNSGKLSDESFEELIDSVKDYIAHKNHREDVEKAISHVESSTSEKELDPSAVSRGSSFER
DDNGLLTLAGGKITDYRKMAEGAMETIINILDKEYNRKFKLINSKTYPVSGGEINPSNVD
SEIEAYAQLGTLSGLSIEDARYIANLYGSNAPKLFALTRQITEAEGLSLVETLSLHYAMD
YEMALSPTDFFLRRTNHMLFMRDNLDSLIQPVIDEMAKHYQWSDQDKTFYEEELHETLKD
NDLAALKDN
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcacgagaaacacgacgtttagccttacaaagaatgcaagatcgtactctg
gatttacttatcataggtgggggtatcacaggcgctggtgtcgctttacaagcagcagct
agtggattagatactggacttattgaaatgcaagattttgcagaagggacaagtagtcgc
tcaacaaaattggtccatggtggtcttcgttacttgaagcaatttgatgtagaagttgtt
tctgatacagtatcagagcgtgcagtcgtgcagcaaattgcaccacacattcctaagcca
gatccaatgcttttaccggtttacgatgagccgggttctacttttagtatgtttcgcctt
aaagtggctatggatttatatgatttattagcaggtgtgacaaatacacccgcagccaat
aaagttttgagcgcagaagatgttcttaagcgtgagcctgatttacaaaaagaaggtttg
ctaggcggagggatctatttagatttccgtaataacgatgcacgtctagtgattgaaaat
attaaacgtgctaatagggatggagcttatattgctagtcatgtcaaagctgaggacttc
ttatttgatgacaacaatcaaattataggagtacgtgcgcgtgatttgttgactgaccaa
gttatcgatataaaagctagacttgttattaatacaactggaccttggagtgacaccgtt
cgcaacttctccaatgaaggtaagcaaattcatcaattacgtccaactaagggagttcac
ttagttgtagatcgccaaaaattaaatgtttctcaacctgtttatgttgatacaggtcta
aatgatggtcgcatgatttttgttttgccacgtgaagataagacttattttggaactaca
gataccgattaccatggagacttagaacatcctacggtaactaaagaagatgttgactac
ctccttaatattgtaaacaaacgtttcccagaagcagagcttactattgatgatattgag
agttcatgggcaggtctgcgtccactactatcagggaatagtgcctctgactataatgga
ggcaatagtggaaaactaagcgatgaaagttttgaagaattaattgattccgttaaagat
tatattgcacataaaaatcatcgtgaggatgttgaaaaagctatttctcatgttgaatct
agtacttctgaaaaagaattggacccatcagctgtttctcgaggatcaagttttgagcgt
gatgataatggtctattaacacttgctggtggtaaaattactgattatcgaaaaatggca
gaaggtgccatggaaactattattaacattttggataaagaatataatcgcaagtttaaa
ctaatcaattctaaaacctatcctgtttcaggaggagagattaacccatctaatgttgat
tctgaaattgaagcttatgctcaattgggcacactaagtggtttaagtattgaggatgca
cgctatattgctaacctttatgggtcaaatgcaccaaaattatttgcattgacacgccaa
attacagaagcagaaggtctgagcttggtagaaacgttgtcacttcactatgctatggat
tatgaaatggcgcttagcccaacggatttcttcttaagacgtacgaatcatatgcttttc
atgagagataatttagattctttgattcagcctgttattgatgagatggctaaacattat
caatggtctgatcaagacaaaaccttctatgaagaagaattacatgagactctaaaagac
aatgacttggcagctttgaaggataattga

DBGET integrated database retrieval system