KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0441Help
Entry
gbs0441           CDS       T00104                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    gbs0441
   00052 Galactose metabolism
    gbs0441
   00500 Starch and sucrose metabolism
    gbs0441
   00520 Amino sugar and nucleotide sugar metabolism
    gbs0441
Enzymes [BR:san01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     gbs0441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(462286..463185)
Genome map
AA seq 299 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSK
RSIEDHFDSNFELEYNLKEKGKNELLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAFVG
NEPFVVMLGDDLMDITNNKVIPLTKQLINDFEATHASTIAVMEVPHEDVSAYGVIAPQGE
GVNGLYSVNTFVEKPSPEEAPSNLAIIGRYLLTPEIFNILETQKPGAGNEIQLTDAIDTL
NKTQRVFARKFTGDRYDVGDKFGFMKTSIDYALQHPQVKDDLKKYIIDLGKSLEKTSKK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcagaaaagcagttatccctgccgctggtttaggaacacgttttttacctgct
actaaagctttagctaaagaaatgcttccaatcgttgataaaccaactattcaatttatt
gttgaagaagcactaaaatctggaattgaagatattttagttgtaactggtaaatcaaaa
cgttctatagaagaccactttgattcaaattttgaattagaatataacctaaaagagaaa
gggaaaaacgaacttctcaaacttgttgatgaaacaactggcattcgactccattttatt
cgacaaagtcatcctcgtgggcttggagatgctgtgctacaagcaaaagccttcgttggt
aatgaaccttttgttgttatgctaggtgatgatctaatggatattaccaataataaagtt
attcctctcaccaaacaattaattaatgactttgaagctactcatgcatcaacaattgct
gttatggaagttccacatgaagatgtttctgcttatggtgttattgctccacaaggagaa
ggagttaatggtctatatagcgttaacactttcgttgaaaaaccttctcccgaagaggct
ccaagtaatttggcaatcattggtcgctacttgttaactccagaaatttttaatatttta
gaaactcaaaaacctggtgcaggaaatgaaattcaactaaccgatgctatcgatacttta
aataaaacgcaacgtgtttttgctagaaaatttacaggagaccgttatgacgttggtgat
aagtttggttttatgaaaacatctattgattatgctcttcaacacccacaagttaaagat
gacttgaagaaatatatcattgatttaggaaaatctctagaaaaaacatctaagaagtaa

DBGET integrated database retrieval system