KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0518Help
Entry
gbs0518           CDS       T00104                                 

Definition
(GenBank) Unknown
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
san00010  Glycolysis / Gluconeogenesis
san00052  Galactose metabolism
san00500  Starch and sucrose metabolism
san00520  Amino sugar and nucleotide sugar metabolism
san00521  Streptomycin biosynthesis
san01100  Metabolic pathways
san01110  Biosynthesis of secondary metabolites
san01120  Microbial metabolism in diverse environments
san01130  Biosynthesis of antibiotics
san01200  Carbon metabolism
Module
san_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
san_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gbs0518
   00052 Galactose metabolism
    gbs0518
   00500 Starch and sucrose metabolism
    gbs0518
   00520 Amino sugar and nucleotide sugar metabolism
    gbs0518
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    gbs0518
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    gbs0518
Enzymes [BR:san01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     gbs0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hexokinase_2
Motif
Other DBs
NCBI-ProteinID: CAD46162
UniProt: Q8E6P5
Position
538770..539738
Genome map
AA seq 322 aa AA seqDB search
MSKKLLGIDLGGTTIKFGILTLEGEVQEKWAIETNTLENGRHIVSDIVESLKHRLSLYGL
TKDDFLGIGMGSPGAVDRTSKTVTGAFNLNWADTQEVGSVIEKEVGIPFFIDNDANVAAL
GERWVGAGANNPDVVFVTLGTGVGGGVIADGNLIHGVAGAGGEIGHMIVDPENGFTCTCG
NKGCLETVASATGVVRVARQLAEQYEGSSAIKAAIDNGDTVTSKDIFIAAEDGDKFANSV
VERVSRYLGLAAANISNILNPDSVVIGGGVSAAGEFLRSRVEKYFVTFAFPQVKKSTKIK
IAELGNDAGIIGAASLANQQAS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaattattgggaattgacctcggaggaacgaccattaaatttggtatcttg
acgcttgagggagaagtacaagaaaaatgggcaattgagaccaatactttagaaaacgga
agacatatcgtttctgatatcgttgaatctctcaaacatcgtttgagcctctatggatta
acaaaagatgactttctcggtatcggtatgggttctccaggagctgttgatagaactagt
aaaacagtaacaggtgcttttaatctaaattgggctgatactcaagaagtaggttcggtt
attgaaaaagaagttggaattccattttttattgataacgatgctaatgttgcagcactt
ggtgaacgctgggtaggtgctggtgccaataatcccgatgttgttttcgtaaccctcgga
acaggagtaggtggaggtgttatcgcagatggtaacctcatccatggtgttgcaggagca
ggtggagaaattgggcatatgattgttgatccagaaaatggatttacgtgcacatgtggt
aacaaaggctgtcttgagacagttgcatcagcgacaggtgttgttagagtagcacgtcaa
ctcgcagaacaatatgaaggttcgtctgccattaaagcagcgattgacaacggtgatact
gttacaagtaaagatatttttatagcagcagaagatggggataaatttgctaattctgtt
gttgaacgtgtatcacgttaccttggactggcagcagctaatatttcaaatattttaaac
cctgattctgtggttattggtggcggtgtctcagcagcaggtgaatttttacgtagtcgc
gttgagaaatactttgtcacatttgctttcccacaagttaaaaagtcaactaaaattaag
attgctgaactaggtaatgatgctggtattattggtgcagcaagcttagccaatcaacaa
gcaagttaa

DBGET integrated database retrieval system