KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0518Help
Entry
gbs0518           CDS       T00104                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    gbs0518
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gbs0518
   00052 Galactose metabolism
    gbs0518
   00500 Starch and sucrose metabolism
    gbs0518
   00520 Amino sugar and nucleotide sugar metabolism
    gbs0518
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    gbs0518
   00524 Butirosin and neomycin biosynthesis
    gbs0518
Enzymes [BR:san01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     gbs0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
538770..539738
Genome map
AA seq 322 aa AA seqDB search
MSKKLLGIDLGGTTIKFGILTLEGEVQEKWAIETNTLENGRHIVSDIVESLKHRLSLYGL
TKDDFLGIGMGSPGAVDRTSKTVTGAFNLNWADTQEVGSVIEKEVGIPFFIDNDANVAAL
GERWVGAGANNPDVVFVTLGTGVGGGVIADGNLIHGVAGAGGEIGHMIVDPENGFTCTCG
NKGCLETVASATGVVRVARQLAEQYEGSSAIKAAIDNGDTVTSKDIFIAAEDGDKFANSV
VERVSRYLGLAAANISNILNPDSVVIGGGVSAAGEFLRSRVEKYFVTFAFPQVKKSTKIK
IAELGNDAGIIGAASLANQQAS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaattattgggaattgacctcggaggaacgaccattaaatttggtatcttg
acgcttgagggagaagtacaagaaaaatgggcaattgagaccaatactttagaaaacgga
agacatatcgtttctgatatcgttgaatctctcaaacatcgtttgagcctctatggatta
acaaaagatgactttctcggtatcggtatgggttctccaggagctgttgatagaactagt
aaaacagtaacaggtgcttttaatctaaattgggctgatactcaagaagtaggttcggtt
attgaaaaagaagttggaattccattttttattgataacgatgctaatgttgcagcactt
ggtgaacgctgggtaggtgctggtgccaataatcccgatgttgttttcgtaaccctcgga
acaggagtaggtggaggtgttatcgcagatggtaacctcatccatggtgttgcaggagca
ggtggagaaattgggcatatgattgttgatccagaaaatggatttacgtgcacatgtggt
aacaaaggctgtcttgagacagttgcatcagcgacaggtgttgttagagtagcacgtcaa
ctcgcagaacaatatgaaggttcgtctgccattaaagcagcgattgacaacggtgatact
gttacaagtaaagatatttttatagcagcagaagatggggataaatttgctaattctgtt
gttgaacgtgtatcacgttaccttggactggcagcagctaatatttcaaatattttaaac
cctgattctgtggttattggtggcggtgtctcagcagcaggtgaatttttacgtagtcgc
gttgagaaatactttgtcacatttgctttcccacaagttaaaaagtcaactaaaattaag
attgctgaactaggtaatgatgctggtattattggtgcagcaagcttagccaatcaacaa
gcaagttaa

DBGET integrated database retrieval system