KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0562Help
Entry
gbs0562           CDS       T00104                                 

Definition
hypothetical protein
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:san01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:san00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:san00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:san00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:san00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
584844..586775
Genome map
AA seq 643 aa AA seqDB search
MSNFYKLLKEKFPRKEDIVTEMINLEAICQLPKGTEYFISDLHGEYDAVDYLLRTGAGSI
RAKLLDCFDWQKIVAVDLDDFCILLYYPKEKLAFDKMNLSASAYKTKLWEMIPLQIQVLK
YFSSKYTKSKVRKQLSGKFAYIIEELLAEIDRNPEKKSYFDTIIEKLFELDQVEDLIIVL
SQTIQVLIIDHLHVVGDIYDRGRYPDRILNRLMAFPNLDIQWGNHDVTWMGAASGSYLCM
VNVIRIAARYNNITLIEDRYGINLRRLVDYSRRYYEPLPSFVPILDGEEMTHPDELDLLN
MIQQATAILQFKLEAQLIDRRPEFQMHNRQLINQVNYKDLSISIKEVVHQLKDFNSRCID
SKNPSRLTSEEEELLQQLMIAFQTSESLKKHIDFLFEKGSMYLTYNDNLLFHGCIPMHSN
GDFKSFKIAGKTYGGRDLLDLFESQIRLAYARPEKHDDLATDIIWYLWCGENSSLFGKNA
MTTFERYYVSDKVTHQERKNPYFKLRDKDDICTALLQEFDLPKFGHIVNGHTPVKEKNGE
QPIKANGKMLVIDGGFAKGYQKNTGLAGYTLIYNSYGIQLISHLPFTSIEEVLSGTNYII
DTKRLVEEAKDRILVKDTTIGQKLTKEIKDLDHLYRHFQEYDD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatttttataagctcttgaaagaaaaatttcctcgaaaagaagatatcgtaaca
gaaatgatcaatttagaagctatttgtcaattacccaaagggacggagtattttattagt
gatttacacggggaatacgatgctgttgattatctcttacggacaggtgcagggtctatt
agagctaaattattagactgttttgattggcagaaaatagttgctgttgatttagatgat
ttttgtatactgctttattacccaaaggaaaaattagccttcgataaaatgaacttgtca
gcaagtgcttataaaacgaagttatgggaaatgattccgttacaaatacaagttttaaaa
tatttttctagtaaatatacaaaatctaaagtacgtaagcaattgtcaggtaagtttgct
tacattatcgaagaacttttagctgagattgaccgtaacccagagaagaaaagctatttt
gatactattattgaaaaattatttgaattagaccaagtagaagatttaattatagtattg
tcccaaacaattcaagttttgattattgaccatttacatgttgtaggggatatttacgat
cgtggtaggtatcctgatcgtatcttgaataggttaatggcttttccaaatttggatatc
caatgggggaaccatgatgtcacttggatgggagcagcatctggttcttacctttgtatg
gtaaatgttatccgtattgctgcacgttataataatattactttaattgaagaccgatat
ggtatcaatttgcgtcgcttggttgattactcacgccgttactatgaacctctaccttct
ttcgttcctatattagatggagaggaaatgactcatccagatgaactagacttgttaaat
atgatacaacaagcaacagcaattttacagtttaaattggaagcccaattgattgacagg
cgtccagaatttcaaatgcataatcggcaacttattaaccaggtaaattataaagattta
agtatatctattaaggaagttgtgcatcaacttaaagattttaatagtagatgcattgat
tcgaaaaatcccagtcgattaacaagtgaggaagaagagcttttacaacaattgatgata
gccttccagacttctgaaagtttaaagaaacatattgatttcctatttgaaaaaggaagt
atgtatttaacatataatgataatcttttattccatggttgcataccaatgcatagtaat
ggtgattttaaaagctttaaaattgcaggaaaaacttatggtggtagggatttactggat
ttatttgaaagtcaaatacgtctagcatatgctagaccagagaaacatgatgatttggcg
acagatatcatttggtatctttggtgtggtgaaaattcttctctttttggtaagaatgcc
atgactacttttgagcgctattatgtttccgacaaagtaactcatcaagaaagaaaaaat
ccctactttaaactgagagataaagatgatatttgcactgctcttttacaagagtttgat
ttgcctaagtttgggcatattgtcaatggtcatacgccagtcaaagaaaaaaatggtgag
caaccgataaaagcaaatggtaagatgttagtaattgatggtggctttgccaaaggttat
cagaaaaatacaggtttagctggctacactttgatttataatagctatgggatacaatta
atttcacaccttccttttacatccattgaggaagttttaagtggaaccaactatatcatt
gatacgaagcgattagtagaagaagccaaggataggattcttgtaaaagatacaactatt
ggacaaaagttaaccaaagagattaaagacttagatcacctttatcgtcattttcaggaa
tatgatgactag

DBGET integrated database retrieval system