KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0783Help
Entry
gbs0783           CDS       T00104                                 

Definition
(GenBank) Unknown
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
san00010  Glycolysis / Gluconeogenesis
san00051  Fructose and mannose metabolism
san00562  Inositol phosphate metabolism
san01100  Metabolic pathways
san01110  Biosynthesis of secondary metabolites
san01120  Microbial metabolism in diverse environments
san01130  Biosynthesis of antibiotics
san01200  Carbon metabolism
san01230  Biosynthesis of amino acids
Module
san_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
san_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gbs0783
   00051 Fructose and mannose metabolism
    gbs0783
   00562 Inositol phosphate metabolism
    gbs0783
Enzymes [BR:san01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     gbs0783
Exosome [BR:san04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   gbs0783
  Exosomal proteins of bladder cancer cells
   gbs0783
  Exosomal proteins of melanoma cells
   gbs0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAD46427
UniProt: Q8E644
Position
803365..804123
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFIEAVASKLPSSELVEAGIAAPALTLSTVLEAAKGSEL
KIAAQNSYFENSGAFTGENSPKVLAEMGTDYVVIGHSERRDYFHETDQDINKKAKAIFAN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALAGLSEEQVSSLVIAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQAVADKVRVQYGGSVKPENVAEYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaataaaaatccagaagaagca
aaagcattcatcgaagcagtagcttctaaattaccatcatcagaacttgttgaagcaggg
attgctgctccagcgcttactttatcaacagttcttgaagcagctaaaggttcagaattg
aaaatcgctgctcaaaatagctattttgagaattcaggtgcattcactggtgaaaacagc
cctaaagtattggctgaaatgggtacagactacgttgttatcggtcactcagaacgtcgt
gattatttccatgaaactgaccaagatatcaacaaaaaagcaaaagctatctttgctaat
ggtttgactccaatcatttgttgcggtgagtctcttgaaacttacgaagctggtaaagcg
gttgaattcgtaggtgctcaagtttcagcagctcttgcaggtttgtcagaagagcaagta
tcatcacttgttatcgcttacgaaccaatctgggctattggtactggtaaatcagcaact
caagacgacgcacaaaacatgtgtaaagcagttcgtgacgttgttgcagcagacttcggt
caagcagttgctgacaaagttcgcgttcaatacggtggttcagttaaacctgaaaacgtt
gcagaatatatggcttgcccagacgttgacggtgcccttgtaggtggagcttcacttgaa
gcagaaagcttccttgccttattagattttgttaaataa

DBGET integrated database retrieval system