KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0783Help
Entry
gbs0783           CDS       T00104                                 

Definition
(GenBank) Unknown
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    gbs0783
   01230 Biosynthesis of amino acids
    gbs0783
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gbs0783
   00051 Fructose and mannose metabolism
    gbs0783
   00562 Inositol phosphate metabolism
    gbs0783
Enzymes [BR:san01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     gbs0783
Exosome [BR:san04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   gbs0783
  Exosomal proteins of bladder cancer cells
   gbs0783
  Exosomal proteins of melanoma cells
   gbs0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
803365..804123
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFIEAVASKLPSSELVEAGIAAPALTLSTVLEAAKGSEL
KIAAQNSYFENSGAFTGENSPKVLAEMGTDYVVIGHSERRDYFHETDQDINKKAKAIFAN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALAGLSEEQVSSLVIAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQAVADKVRVQYGGSVKPENVAEYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaataaaaatccagaagaagca
aaagcattcatcgaagcagtagcttctaaattaccatcatcagaacttgttgaagcaggg
attgctgctccagcgcttactttatcaacagttcttgaagcagctaaaggttcagaattg
aaaatcgctgctcaaaatagctattttgagaattcaggtgcattcactggtgaaaacagc
cctaaagtattggctgaaatgggtacagactacgttgttatcggtcactcagaacgtcgt
gattatttccatgaaactgaccaagatatcaacaaaaaagcaaaagctatctttgctaat
ggtttgactccaatcatttgttgcggtgagtctcttgaaacttacgaagctggtaaagcg
gttgaattcgtaggtgctcaagtttcagcagctcttgcaggtttgtcagaagagcaagta
tcatcacttgttatcgcttacgaaccaatctgggctattggtactggtaaatcagcaact
caagacgacgcacaaaacatgtgtaaagcagttcgtgacgttgttgcagcagacttcggt
caagcagttgctgacaaagttcgcgttcaatacggtggttcagttaaacctgaaaacgtt
gcagaatatatggcttgcccagacgttgacggtgcccttgtaggtggagcttcacttgaa
gcagaaagcttccttgccttattagattttgttaaataa

DBGET integrated database retrieval system