KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0784Help
Entry
gbs0784           CDS       T00104                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    gbs0784 (gpmA)
   01230 Biosynthesis of amino acids
    gbs0784 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gbs0784 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    gbs0784 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    gbs0784 (gpmA)
Enzymes [BR:san01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     gbs0784 (gpmA)
Exosome [BR:san04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   gbs0784 (gpmA)
  Exosomal proteins of melanoma cells
   gbs0784 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
804300..804992
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIQAAGIEFDLAFTSVLKR
AIKTTNLALEAADQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPDMAKDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFEFDEKLNLVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattagtattcgcacgccacggtgaatctgagtggaataaagctaaccttttc
actggatgggctgacgtagatctttcagaaaaaggtacacaacaagctattgatgctggg
aaattaattcaagcagcaggtattgagttcgaccttgcttttacatcagttcttaaacgt
gccatcaaaacaactaaccttgcccttgaagcagctgatcaactttgggtaccagttgaa
aaatcatggcgcttgaacgaacgtcattacggtggattgacaggaaaaaataaagcagaa
gcagctgaacaatttggtgatgagcaagttcatatttggcgtcgttcatatgatgtattg
cctccagatatggctaaagatgatgaacattcagcacatactgatcgtcgctatgcttca
ctagatgattctgttattccagatgcagaaaacctaaaagttactttagagcgtgctctt
cctttctgggaagataaaattgctcctgctcttaaagatggtaaaaatgtgtttgttggt
gcacacggtaactcaatccgtgctcttgtaaaacatatcaaacaattgtcagatgatgaa
atcatggacgttgaaattcctaacttcccaccacttgttttcgaatttgatgaaaaatta
aaccttgtttcagaatattacttaggtaaataa

DBGET integrated database retrieval system