KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0784Help
Entry
gbs0784           CDS       T00104                                 

Definition
(GenBank) Unknown
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
san00010  Glycolysis / Gluconeogenesis
san00260  Glycine, serine and threonine metabolism
san00680  Methane metabolism
san01100  Metabolic pathways
san01110  Biosynthesis of secondary metabolites
san01120  Microbial metabolism in diverse environments
san01130  Biosynthesis of antibiotics
san01200  Carbon metabolism
san01230  Biosynthesis of amino acids
Module
san_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
san_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gbs0784
  Energy metabolism
   00680 Methane metabolism
    gbs0784
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    gbs0784
Enzymes [BR:san01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     gbs0784
Membrane trafficking [BR:san04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    gbs0784
Exosome [BR:san04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   gbs0784
  Exosomal proteins of melanoma cells
   gbs0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAD46428
UniProt: Q8E643
Position
804300..804992
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIQAAGIEFDLAFTSVLKR
AIKTTNLALEAADQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPDMAKDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFEFDEKLNLVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattagtattcgcacgccacggtgaatctgagtggaataaagctaaccttttc
actggatgggctgacgtagatctttcagaaaaaggtacacaacaagctattgatgctggg
aaattaattcaagcagcaggtattgagttcgaccttgcttttacatcagttcttaaacgt
gccatcaaaacaactaaccttgcccttgaagcagctgatcaactttgggtaccagttgaa
aaatcatggcgcttgaacgaacgtcattacggtggattgacaggaaaaaataaagcagaa
gcagctgaacaatttggtgatgagcaagttcatatttggcgtcgttcatatgatgtattg
cctccagatatggctaaagatgatgaacattcagcacatactgatcgtcgctatgcttca
ctagatgattctgttattccagatgcagaaaacctaaaagttactttagagcgtgctctt
cctttctgggaagataaaattgctcctgctcttaaagatggtaaaaatgtgtttgttggt
gcacacggtaactcaatccgtgctcttgtaaaacatatcaaacaattgtcagatgatgaa
atcatggacgttgaaattcctaacttcccaccacttgttttcgaatttgatgaaaaatta
aaccttgtttcagaatattacttaggtaaataa

DBGET integrated database retrieval system