KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0786Help
Entry
gbs0786           CDS       T00104                                 

Definition
(GenBank) Unknown
  KO
K06187  
recombination protein RecR
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:san00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    gbs0786
DNA repair and recombination proteins [BR:san03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     gbs0786
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      gbs0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
807181..807777
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSFSKLPGIGTKTATRLAFYTIGMSDEDVNEFAKNLLAAKRELTYCSVC
GNLTDDDPCLICTDKTRDQSVILVVEDSKDVSAMEKIQEYNGLYHVLHGLISPMNGISPD
DINLKSLITRLMDGQVTEVIVATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttacccaacaccaattgctaaattgattgacagcttttcaaaattaccgggtata
ggtactaaaacagcaacacgtttagctttttacaccattggtatgagtgatgaagatgtt
aatgaatttgctaagaatttattagctgctaagcgggaattaacctattgttctgtttgt
ggtaatttgactgatgatgatccttgcttaatttgtacagataagacgcgtgaccagtct
gttatcttggttgttgaagatagtaaagatgtgtcagctatggaaaaaattcaagagtat
aatggtttgtatcatgtcttacatggcttaatttcacctatgaatggtattagccctgat
gacattaatttgaaaagtttaattactcgattgatggatggtcaggtgacagaagttatt
gttgctaccaatgcgactgctgatggtgaagctacatcaatgtatatttcacgagtctta
aaaccagctggtatcaaagtgacacgattagcgagaggtttagctgttggttcagatatc
gaatatgcagatgaagtaaccttgcttcgagcaatcgaaaatcgtacagagttataa

DBGET integrated database retrieval system