KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0871Help
Entry
gbs0871           CDS       T00104                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    gbs0871
Enzymes [BR:san01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     gbs0871
Exosome [BR:san04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   gbs0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
897517..899385
Genome map
AA seq 622 aa AA seqDB search
MSNKDELYTFGIGENFHLQNYLGVHSENESFCFRVWAPNAENVQVIGDFTDWRNRPLQMN
KNQAGVWEANSLDAREGDLYKYLVTRKGGQVVEKIDPMAVYMERRPGTASVIKVLRNKKW
EDGLWMGRRKRLGFQKRPINIYEVHAGSWKKDDFGHPMTFSQLKDYLIPYLVEMNYTHVE
FMPLMAHPLDMSWGYQLMGYFAFEHTYGTPEEFQDFVEACHKNNIGVLVDWVPGHFIQND
DALAYFDGTATYEYQNHDRAHNYRWGALNFDLGKNQVQSFLISSALFWIEHYHIDGIRVD
AVSNMLYLDYDEGPWEANQFGDNRNLEGYYFLRKLNKVIKERHPNVMMIAEESTASTPIT
KDLESGGLGFDFKWNMGWMNDILRFYEEDPLYRQYDFNLVTFSFMYIFNENFVLAFSHDE
VVHGKKSMMHKMWGDRYNQFAGLRNLYAYQMCHPGKKLLFMGSEFGQFLEWKYNDQLEWE
NLNDDMNQKMQRYTKQLNQFYKDHKCLWRIDDSFDGIEIIDADNKSETVLSFIRKDDKGD
LLLCVFNMTPVERPNFTIGVPQAGIYEEVLNTEMEEFGGVWKNHNPVTKTQVATWKDYDH
TLSFTLPALGASVWRIKRRLRK
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtccaataaagatgagttatatacttttggaataggtgaaaattttcatctccagaat
tatttaggcgtacatagcgaaaatgaaagcttttgtttcagagtttgggctcctaatgct
gaaaatgttcaagttattggagattttacagattggcgaaatcgtcctctccaaatgaac
aaaaatcaagcaggagtttgggaagctaatagtttggatgcgcgcgaaggtgatttatat
aaatatttggttactcgtaaaggtggtcaagtagttgagaaaatcgatcctatggcagtt
tatatggaaagacgtcctggaactgcaagtgttattaaagtgcttagaaataaaaagtgg
gaagatggcctttggatgggaaggcgcaaacgtctggggtttcagaagcgtccaattaat
atttacgaagttcatgctggttcatggaaaaaagatgattttggacatcctatgactttt
tctcagttaaaagactacttaatcccctaccttgttgagatgaattatactcatgttgaa
tttatgcccttaatggcacatccgcttgatatgagttggggatatcaattaatggggtat
tttgcttttgaacatacctatggtactccagaagaatttcaagactttgtagaagcatgt
cataaaaataatataggagttcttgtagattgggttccaggacactttattcagaatgat
gatgctttagcctatttcgatggaactgctacatatgagtatcaaaatcatgatcgtgcg
cataactatcgatggggagctctgaactttgatttaggaaaaaatcaagtacaatccttt
ttgatttcgagtgccttattctggattgaacattatcatattgatggtattcgtgttgat
gcggttagtaatatgttatatctcgattatgatgaaggaccatgggaagctaaccaattt
ggggataatcgtaatttggaagggtattactttttaaggaaacttaacaaagtaattaaa
gagcgtcatcctaatgttatgatgattgctgaagagtcaacagcttctaccccaataact
aaagacttagagtctggaggattgggttttgactttaaatggaatatgggctggatgaat
gatatcctacgtttttatgaagaagatcctctctataggcaatatgattttaatttagtg
acttttagttttatgtatatattcaatgagaactttgtactagctttttcacatgatgaa
gtagtacatggtaaaaagagtatgatgcataaaatgtggggtgaccgttataatcaattt
gctggtttacgtaacttatatgcatatcaaatgtgtcatcctggaaaaaaacttctcttt
atgggaagtgagttcggtcaatttttagaatggaaatataatgatcaactagaatgggaa
aacttaaatgatgatatgaaccaaaagatgcaacgctatactaaacaattgaatcaattt
tataaagatcataagtgcctatggcgtattgatgattcctttgatgggatagaaattatt
gatgcagataataaatctgaaactgttttatcttttatacgaaaagatgataaaggggat
ttgttactttgtgtctttaatatgactcctgtagaacgccctaactttactattggtgtt
ccacaagcgggtatttatgaagaagttttaaatactgaaatggaagagtttggaggtgtc
tggaaaaaccacaatcctgtaacgaaaacacaagtggctacatggaaagattatgatcat
actttaagttttacattaccagcccttggggcaagtgtttggagaataaaacgtcggctt
cgtaaataa

DBGET integrated database retrieval system