KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0901Help
Entry
gbs0901           CDS       T00104                                 

Definition
mur ligase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    gbs0901
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    gbs0901
Enzymes [BR:san01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     gbs0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(936443..937786)
Genome map
AA seq 447 aa AA seqDB search
MKINTALGVAAGKSAHYLLSKMGRGSTYPGSLALKFDKDILDTIAKDYEIVVVTGTNGKT
LTTALTVGILKEAFGQVVTNPSGANMITGIVSTFLTAKKSKSGKKIAVLEIDEASLPRIT
QYIKPSLFVFTNIFRDQMDRYGEIYTTYQMILDGAANAPQATILANGDSPLFNSKSVTNP
VQFYGFDTDKHEPRLAHYNTEGILCPKCQAILTYRLNTYANLGDYTCPNCDFERPNLDYA
LTRLTHLTNTSSGFVIDGQQYNINVGGLYNIYNALAAVSVAEYFGVEPSQIKDGFDKSRA
VFGRQETFTIGNKKCTLVLIKNPVGASQALDMIKLAPYPFSLSVLLNANYADGIDTSWIW
DANFETILTMNIPEIFAGGVRHSEIARRLRVTGYDEKRIKQADKLQDIMAMIEQQETEHA
YILATYTAMLEFREILANHNAIRKEMN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaatacagcactaggagtggctgccggtaagtctgctcattaccttttaagt
aaaatgggacgtggctctacttatccgggtagtttagcactcaaattcgataaagatata
ctagatacaattgccaaagattatgaaattgtagttgtgactggtactaacggtaaaacc
ttaacaacagctttaacagttggtattttaaaggaagccttcggtcaggtggtaaccaac
ccaagtggagcaaatatgattacaggtattgtttcgaccttcctaacagctaagaaaagt
aaatctggtaaaaaaatagctgttcttgaaatagacgaagcgagtttaccccgtattaca
cagtatataaagcctagtttgttcgtctttaccaatattttccgtgatcaaatggaccgt
tatggcgaaatctacacaacttatcaaatgattttagatggagctgctaacgctccgcaa
gctactatcttagctaacggtgacagtccactttttaattctaaaagcgtgactaaccct
gtgcaattctatggatttgataccgacaaacatgagccacgattagcacactataatact
gagggtattctctgtccaaagtgtcaagcaattttaacttatcgattgaacacatatgcc
aaccttggtgactacacttgtcctaattgtgattttgaacgtccaaaccttgattatgcc
ttaacaaggctaacacatctgacaaatacttcatcaggtttcgttattgatggccaacaa
tataatatcaacgtgggtggcctttataatatttacaatgctttggcggcagtatctgtt
gctgaatattttggtgtagaaccaagtcaaattaaggatggatttgataaaagccgtgcc
gtttttggtcgtcaagaaacctttacaattggaaataaaaaatgtactttagttctgatt
aaaaatccggtaggagctagtcaagctcttgatatgattaaacttgctccatacccgttc
tctctctcagtactactgaatgccaattatgctgacggtattgatacttcttggatttgg
gacgctaattttgaaactattctcacgatgaatatcccagaaatatttgctggtggtgtt
cgccactctgaaattgctcgtcgcttacgtgtaactggttatgatgagaaacgcataaaa
caagctgataaactgcaagatattatggcaatgattgagcagcaagagactgagcatgct
tatattttagcaacatatacagctatgctggagtttcgtgaaattcttgctaaccacaac
gctatcagaaaggagatgaattaa

DBGET integrated database retrieval system