KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0930Help
Entry
gbs0930           CDS       T00104                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    gbs0930 (pfkA)
   01230 Biosynthesis of amino acids
    gbs0930 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gbs0930 (pfkA)
   00030 Pentose phosphate pathway
    gbs0930 (pfkA)
   00051 Fructose and mannose metabolism
    gbs0930 (pfkA)
   00052 Galactose metabolism
    gbs0930 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    gbs0930 (pfkA)
Enzymes [BR:san01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     gbs0930 (pfkA)
Protein phosphatases and associated proteins [BR:san01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     gbs0930 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
971707..972729
Genome map
AA seq 340 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINQGYYGMVTGDIFPLDANSVGDT
INRGGTFLRSARYPEFAELEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVATAVENLDRLRDTSASHNRTFVVEVMGRNAGDIALWS
GIAAGADQIIVPEEEFNIDEVVSNVRAGYAAGKHHQIIVLAEGVMSGDEFAKTMKAAGDD
SDLRVTNLGHLLRGGSPTARDRVLASRMGAYAVQLLKEGRGGLAVGVHNEEMVESPILGL
AEEGALFSLTDEGKIVVNNPHKADLRLAALNRDLANQSSK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaactagtggtggtgacgcccctggtatgaacgctgctatc
cgtgcagttgttcgtaaagcaatttctgaaggtatggaagtttacggcatcaaccaaggt
tactatggtatggtgacaggggatattttccctttggatgctaattctgttggggatact
atcaaccgtggaggaacgtttttacgttcagcacgttatcctgaatttgctgaacttgaa
ggtcagcttaaagggattgaacagcttaaaaaacacggcattgaaggtgtagtagttatc
ggtggtgatggttcttatcatggtgctatgcgtctaactgagcacggtttcccagctgtt
ggtttgccgggtacaattgataatgatatcgttggcactgactatactattggttttgac
acagcagttgcgacagcagttgagaatcttgaccgtcttcgtgatacatcagcaagtcat
aaccgtacttttgttgttgaggttatgggaagaaatgcaggagatatcgctctttggtca
ggtatcgctgcaggtgcagatcaaattattgttcctgaagaagagttcaatattgatgaa
gttgtctcaaatgttagagctggctatgcagctggtaaacatcaccaaatcatcgtcctt
gcagaaggtgttatgagtggtgatgagtttgcaaaaacaatgaaagcagcaggagacgat
agcgatcttcgtgtgacgaatttaggacatctgctccgtggtggtagtccgactgctcgt
gatcgtgtcttagcatctcgtatgggagcgtacgctgttcaattgttgaaagaaggtcgt
ggcggtttggccgttggtgtccacaacgaagaaatggttgaaagtccaattttaggttta
gcagaagaaggtgctttgttcagcttgactgatgaaggaaaaatcgttgttaataatccg
cataaagcggaccttcgcttggcagcacttaatcgtgaccttgccaaccaaagtagtaaa
taa

DBGET integrated database retrieval system