KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs1684Help
Entry
gbs1684           CDS       T00104                                 

Definition
zinc-containing alcohol dehydrogenase
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    gbs1684
Enzymes [BR:san01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     gbs1684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1742959..1744014
Genome map
AA seq 351 aa AA seqDB search
MRAATYLSANELSLTDKAKPQVIKPTDAVVRLVKTTICGTDLHILGGDVPACKPGTTLGH
EGIGIVEEVGSAVNHFKVGDKVIISCVTACNTCYYCKHQLPSHCEDGGWILGHLIEGTQA
EYVHIPHADGSLYHAPEGVCDDALVMLSDILPTSYEIGVLPSHIKPGDTVCIVGAGAIGL
SALLTAQFYSPAKIIMVDLSQKRLEASKKFGATHTILSTSTQEVKEEIDKITKGRGVDVV
LECVGYPATFDICQNVVSIGGHIANVGVHGKPVEFNLQDLWIKNITLNTGLVNANTTEML
LEVLETGKIDATQLVTHHFKLSEIEEAYKVFKAAEENNTLKVIIENDITPA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagagctgcaacttatctttcagctaatgaattatcacttactgataaggctaaacct
caagtaataaaacccacagatgcggttgtaagacttgtcaaaacaaccatttgtggtact
gatctacatatccttggtggcgatgttcctgcttgtaaaccaggaacaactttaggtcat
gaaggcattggtatcgtcgaagaagttggttctgctgtcaatcattttaaagtcggagat
aaagtaattatttcttgtgtcactgcctgtaatacttgctattactgtaagcaccagttg
ccttcacattgtgaagatggcgggtggattttaggacatcttattgaaggtactcaagca
gaatatgttcatattccacatgcagatggtagcctttatcatgcacctgaaggtgtttgt
gacgatgcattggttatgttatctgatattttaccaacttcatacgaaatcggcgtctta
ccttctcacattaaaccaggtgatactgtttgtattgtaggcgctggagcaattggacta
tctgccttactaactgcacaattctattctcctgccaaaattattatggttgatttatct
caaaaacgacttgaagcctctaaaaaatttggtgcaacacacaccattctatcaacgtct
actcaagaagttaaagaagaaattgataaaattaccaaaggccgtggcgttgatgtcgta
ttagaatgtgttggttatcctgcaacatttgatatttgtcaaaatgtagtttctattgga
ggacatatcgcaaatgttggtgttcatggtaaacctgttgaatttaacctccaagattta
tggataaaaaatataacccttaatactggattagttaatgctaatacaactgaaatgctc
cttgaagttcttgagacaggcaaaatcgatgcaacacaactagtaacacatcacttcaag
ctatctgaaatcgaagaagcttataaggtatttaaagctgctgaagaaaacaatactctc
aaagttatcatcgaaaacgatattactccagcctga

DBGET integrated database retrieval system