KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs1720Help
Entry
gbs1720           CDS       T00104                                 

Definition
(RefSeq) aminotransferase AlaT (EC:2.6.1.2)
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    gbs1720
   01230 Biosynthesis of amino acids
    gbs1720
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    gbs1720
   00290 Valine, leucine and isoleucine biosynthesis
    gbs1720
   00220 Arginine biosynthesis
    gbs1720
Enzymes [BR:san01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     gbs1720
    2.6.1.66  valine---pyruvate transaminase
     gbs1720
Amino acid related enzymes [BR:san01007]
 Aminotransferase (transaminase)
  Class I
   gbs1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1774814..1776025)
Genome map
AA seq 403 aa AA seqDB search
MKIFDKSMKLEHVAYDIRGPVLEEADRMRANGEKILRLNTGNPAAFGFEAPDEVIRDLIT
NARESEGYSDSKGIFSARKAVMQYYQLQNIHVDMDDIYIVNGVSEGISMSMQALLDNDDE
VLVPMPDYPLWTACVSLAGGNAVHYICDEEANWYPDIDDIKSKITSKTKAIVLINPNNPT
GAVYPREILQEIVDIARQNDLIIFSDEVYDRLVMDGMEHIPIASIAEDIFTVTLSGLSKS
HRICGFRVGWMVLSGPRQHVKGYIEGLNMLANMRLCSNVLAQQVIQTSLGGQQSIDSMLL
PGGRIYEQRNYIHKAINEIPGLSAVKPNAGLYLFPKIDTDMYRIDNDEEFVLNFLKQEKV
LLTHGRGFNMNTADHFRIVYLPRVDELTELQEKMARFLSQYKR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagatatttgataaatcaatgaagctggaacatgtggcttatgatattagaggccct
gttttagaagaggcggaccgcatgagggcaaatggtgaaaagatattgcggttaaacact
ggaaatccagctgcctttggcttcgaagcgccagatgaagtcattcgtgatttaattacg
aatgcgcgtgaatcagaaggttactctgattcgaaaggtattttttcagctcgtaaggct
gttatgcagtattaccagttacaaaacatccatgttgacatggatgatatatacattgtt
aatggtgttagtgagggaatctctatgtcaatgcaagctttgcttgataatgatgacgag
gttctagttccaatgccagattacccgttatggacagcttgtgttagccttgctggtgga
aatgctgtgcattatatttgtgatgaggaagctaattggtatcctgatattgatgatatc
aaatcaaaaatcacatccaaaacaaaagcaattgtcctcattaatccaaataatccaact
ggagcagtctatccgcgtgaaattttgcaagagattgtggatattgctagacaaaatgac
ttgattattttttcagacgaggtttatgaccgtttagttatggatggaatggagcatatc
ccaattgcttctattgcagaggatatttttacagttactttatctggcttatctaaatca
catcgcatctgtggtttccgcgttggttggatggtattgtctggtccgcgacaacatgtt
aaaggttatattgaaggtttgaatatgttagctaacatgaggctgtgttcaaatgttctt
gctcaacaggttattcaaacatcgttaggcggacagcaatctattgatagtatgttgttg
ccaggaggtcgtatctacgagcaacgtaattatatccataaagcaattaatgaaatacct
ggtttatctgctgtaaaaccaaatgctggactgtatcttttccctaaaattgatacagat
atgtaccgtattgataatgatgaagagtttgtgcttaatttcttaaaacaagaaaaagta
ttactaacacacggtagaggatttaatatgaataccgctgaccattttagaattgtttac
ttaccacgtgttgatgaattgactgaactacaagaaaaaatggctcgctttttaagccaa
tacaagcgctag

DBGET integrated database retrieval system