KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs1769Help
Entry
gbs1769           CDS       T00104                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:san03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1827434..1829854
Genome map
AA seq 806 aa AA seqDB search
MEVFFTGTIERIIFENASNFFKILLLEIEDTDSDFDDVEVIITGTMADVIEGEEYTFWGT
LTQHPKYGEQLQSVRYERAKPTSGGLVKYFSSEQFKGIGKKTAQRIVELYGDNTIDKILE
SPEQLSTISGLSKINREAFIAKLKLNYGTEQVLAKLAEYGLSNRAAIQIFDHYKEESLEV
INENPYQLVEDIQGIGFKIADQLAEQVGIESDSPKRFRAAIIHTLVESSMEQGDTYIEAR
TLLEKTITLLEEVRQIELDPSIVAKELTNLIAEDKVQHIGTKIFSNTLFFAEEGIKKNLQ
RILNQPLDKQLSHKDIDREIRDIQKSLNIHYDNIQEKAIREALLSKVFILTGGPGTGKTT
VINGIIEAYSELHHIDLNKNDIPIVLAAPTGRAARRMNELTGLPSATIHRHLGLNGDSDY
QSLDDYLDCSLIIIDEFSMVDTWLANQLFDALDSHTQVIIVGDSDQLPSVGPGQVLADLL
NINALPHIKLEKIFRQSEESTIVTLANQMRQGFLPEDFTAKKADRSYFEASANIIPNMIS
KIVQSALKSGIEAHEIQILAPMYRGQAGINNLNLIMQNLLNPLKDNNQFTFNDINFRIGD
KVLHLVNDTELNVFNGDIGYITDLIPAKYTESKQDEIYMTFDGQEVIYQRKEWLKITLAY
AMSIHKSQGSEFQVVILPITRQSGRMLQRNLIYTAITRSKSKLILLGEIGAFDFAVKNEG
AKRNTYLIERFENKQEIANSQKIEDSSIDQKIDNTIINTSIPKTATPIEQTNLSKITYRL
TEENYLTIDPMIGINQQDISAIFDSK
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggaagtattttttacaggaaccattgaacgcattatatttgaaaatgccagcaatttt
tttaaaatattacttctggaaatcgaagatacggatagcgattttgatgatgtagaagta
attattactggtactatggccgacgttatagagggagaagaatatactttttggggaaca
ctaacccaacatccaaaatacggcgagcaactacaaagtgtacgctatgaaagagccaag
cctacttcaggtggccttgtgaaatacttttctagcgaacaatttaaaggaattggtaaa
aagactgcccaacgcatcgtagaactctatggagataataccattgataaaatccttgaa
tcccctgaacagttaagtacaatctcaggactatcaaaaattaatagagaagcattcatc
gctaaactgaaactcaattatggaacagagcaagttttagctaaactcgctgaatatggg
ttaagcaatcgtgctgctattcaaatatttgatcactataaagaagaatcacttgaagtg
ataaacgaaaatccttatcaacttgttgaggatatccaaggtatcggttttaaaatagct
gaccaacttgctgaacaagtcggtattgaaagtgattctcctaaacgctttcgtgctgct
attattcatactttagttgagtcttctatggagcaaggagatacctatattgaggctcgt
actctcttggaaaaaaccattactctccttgaagaagttcgtcaaatcgaactagatcct
tcaattgttgctaaggaattgacaaatttaattgcagaagataaagtgcaacatattgga
actaaaatttttagtaatactctattttttgccgaagaaggcatcaaaaaaaacttacaa
cgaatactaaatcagcctcttgataaacaactaagtcacaaagatattgaccgtgaaatc
agagatattcaaaaatctttaaatatccactacgataatatccaagaaaaagctattaga
gaagctttactaagtaaggtatttatcttgactggtggcccaggaacaggtaaaacaaca
gttataaatggtattattgaagcctattccgagttacatcatattgatttaaacaaaaat
gatattcctattgtacttgctgctcctacaggtcgtgctgctagacgcatgaatgaactt
accggtttaccgagtgctactattcataggcatttgggattaaacggagatagtgactat
caaagtctagatgactatctagattgttccttaattatcattgatgaattttcaatggtt
gacacttggcttgctaatcaattatttgacgctttggactcgcacacacaagttattatt
gtcggagatagtgatcaattaccgtctgtaggtccaggacaagttctagcagatctttta
aatataaatgcacttccacacattaaacttgaaaagatttttagacaatcagaagaatca
actattgtgactttagctaatcaaatgagacagggctttttgccagaggactttacagct
aaaaaagccgatcgctcatactttgaagcatctgctaatatcatcccaaatatgatttct
aaaattgttcaatctgcacttaagagcggtattgaagctcatgaaattcaaattttagct
cctatgtatcgcggccaagcaggtattaataatcttaaccttatcatgcaaaatctcctc
aatccattaaaagataataaccaatttacttttaatgatataaatttccgaataggagat
aaagtgttacatttagtcaacgatacagagcttaatgtttttaatggggatattggttac
ataacggaccttataccagctaaatatactgagagcaagcaagatgagatttatatgact
tttgatggtcaagaagttatctaccaacgcaaagaatggcttaaaataacactagcctat
gctatgagtattcataaatcacagggttctgaatttcaagttgttattctgccaataacg
agacagagtggtcgaatgttacagcgaaaccttatttatacagctattacgagatctaaa
agtaaactaatacttttaggagaaattggtgcatttgatttcgctgttaaaaacgagggg
gcaaagcgcaatacttatctgatagaaagatttgaaaacaagcaagaaatagctaattct
caaaaaattgaagatagctcaatagatcaaaagattgacaacacaataattaatacgtcc
attccaaaaacagcaacaccaattgagcagactaatctttcaaaaataacttatcgccta
actgaagaaaattatttaacaatcgatccaatgattggtattaatcaacaagatataagt
gcaatttttgatagtaaataa

DBGET integrated database retrieval system